(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIM

BX640427.FLIM        Location/Qualifiers
FT   CDS             complement(216381..217391)
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /gene_synonym="fla AII"
FT                   /gene_synonym="fla QII"
FT                   /gene_synonym="CheC2"
FT                   /locus_tag="BPP1503"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1394"
FT                   /db_xref="GOA:Q7WA83"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA83"
FT                   /protein_id="CAE36805.1"
FT                   /translation="MAYEAFLSQDEVDALLAGVTGESDEKQPAGDEAGAPRAYDLSSPE
FT                   RVVRRRMQTLELINERFARHMRNVLLNFMRRNADITVGAIKILKYADFERNLPVPSNLN
FT                   MIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTL
FT                   ESYGKSWDPVYPIEFEYVRSEMHTKFASITGNNEVVVVSPFHIEFGATGGDLNICLPYS
FT                   MIEPVRDLLTRPLQDTALEEVDQRWAQQLQSQVRSADIDLVAEFGHIPSSIGELMRMKT
FT                   GDVLPIAVPETVTAHVDGVPLMEYGYGVFNGRYALRVQNLINYDDTDSNEAPDHD"
     MAYEAFLSQD EVDALLAGVT GESDEKQPAG DEAGAPRAYD LSSPERVVRR RMQTLELINE        60
     RFARHMRNVL LNFMRRNADI TVGAIKILKY ADFERNLPVP SNLNMIQMKP LRGTALFTYD       120
     PNLVFLVIDS LFGGDGRYHT RVEGRDFTTT EQRIIRRLLN LTLESYGKSW DPVYPIEFEY       180
     VRSEMHTKFA SITGNNEVVV VSPFHIEFGA TGGDLNICLP YSMIEPVRDL LTRPLQDTAL       240
     EEVDQRWAQQ LQSQVRSADI DLVAEFGHIP SSIGELMRMK TGDVLPIAVP ETVTAHVDGV       300
     PLMEYGYGVF NGRYALRVQN LINYDDTDSN EAPDHD                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page