(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIO

BX640427.FLIO        Location/Qualifiers
FT   CDS             complement(215518..215859)
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /gene_synonym="flbD"
FT                   /gene_synonym="flaP"
FT                   /locus_tag="BPP1501"
FT                   /product="flagellar protein FliO"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1392"
FT                   /db_xref="GOA:Q7WA84"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA84"
FT                   /protein_id="CAE36803.1"
FT                   /translation="MTESAVLRVVIGLALVIAAILVSAWLARRSGLIQRHGGALLRQVG
FT                   GMSLGPRQRVVVLEIEGTWLVLGVTPNQLTTLHTLPAGQLPDPSPAAAGTFAAKLGQAL
FT                   QRGHRVDRP"
     MTESAVLRVV IGLALVIAAI LVSAWLARRS GLIQRHGGAL LRQVGGMSLG PRQRVVVLEI        60
     EGTWLVLGVT PNQLTTLHTL PAGQLPDPSP AAAGTFAAKL GQALQRGHRV DRP              113
//

If you have problems or comments...

PBIL Back to PBIL home page