(data stored in ACNUC1104 zone)

EMBL: BX640427.FLIT

BX640427.FLIT        Location/Qualifiers
FT   CDS             complement(227396..227776)
FT                   /transl_table=11
FT                   /gene="fliT"
FT                   /locus_tag="BPP1515"
FT                   /product="flagellar protein FliT"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1408"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA72"
FT                   /protein_id="CAE36817.1"
FT                   /translation="MSSRPQREKSMTALTQHAPVLEIYQDIANLTSRMLAAANASNWDL
FT                   VLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSD
FT                   LLGRMKRQQSLLATYSGKANGT"
     MSSRPQREKS MTALTQHAPV LEIYQDIANL TSRMLAAANA SNWDLVLNHG QEYVCLVERL        60
     RELEPGEPLD EAARGMKFDL LVRILENDAA VRDLALPQLA RLSDLLGRMK RQQSLLATYS       120
     GKANGT                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page