(data stored in ACNUC1104 zone)

EMBL: BX640427.GLND

BX640427.GLND        Location/Qualifiers
FT   CDS             complement(236164..238761)
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BPP1525"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1417"
FT                   /db_xref="GOA:Q7WA62"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA62"
FT                   /protein_id="CAE36827.1"
FT                   /translation="MPHVDLNPLKQRMQAARAAAVAQFRQHPRPDMLLTELRRIVDQAL
FT                   RELVKLCPLPAGATLAAVGGYGRGELYPHSDVDLLILLPQPPSAADARAVEALVAALWD
FT                   LGLEPGHSVRTLEDCEREARGDITVETALLESRWLAGSRTLMKRLDSAMQARLDAAVFF
FT                   QAKRVEMQQRHARYQDTPYALEPNCKESPGGLRDLQVILWMARAAGFGHSWREVAQAGL
FT                   LTSSEARDLRRAEQAFKRLRIELHLLTGRREDRVLFDLQPGLAAVYGIASTATRRASEL
FT                   LMQRYYWAARLVTQLNVILVQNIEERLFPRPDSDARLIDDDFRNLRERLDIVREDGFER
FT                   NPTLLLRAFLVMQQHPELIGMSARTLRAIWHSRHRIDAQFRRNPVNRKLFLQILQQPRG
FT                   IVHELRRMTMLNILPRYLPVFRRIVGQMQHDLFHVYTVDQHTLAVVRNLRRFTMPEHAQ
FT                   EYPLASQLIAGLDRHWLLYVAALFHDIAKGRGGDHSELGAREVRRFAQDHGLDPADAEL
FT                   VEFLVRHHLLMSAVAQKRDLSDPQVVRDFAAQVGDERRLAALYLLTVADIRGTSPRVWN
FT                   AWKGKLLEDLFRLALAALGGAHADAHTVLTERKDEAARLTRLAGLRDDAREAFWNQLDI
FT                   AYFLRHDASEIAWHTRHLYYQVAPDEPVVRVRPTEHGEGLQVMVYTRDAPDLFVTTCGY
FT                   FDAKSLSVQDARVHTTRHGWALDSFIVLAPEGFADLRAQATLVEHELAERLRDPHAARH
FT                   AHAPRRLPHSHARRSRVFPVMPQAELSPDERSQSWRLSVTATDRPGLLYALARVFAEHG
FT                   VDLIMAKIMTLGERVEDVFIVSGSALERPRSQMQFERAILDALAGDEPRQQAA"
     MPHVDLNPLK QRMQAARAAA VAQFRQHPRP DMLLTELRRI VDQALRELVK LCPLPAGATL        60
     AAVGGYGRGE LYPHSDVDLL ILLPQPPSAA DARAVEALVA ALWDLGLEPG HSVRTLEDCE       120
     REARGDITVE TALLESRWLA GSRTLMKRLD SAMQARLDAA VFFQAKRVEM QQRHARYQDT       180
     PYALEPNCKE SPGGLRDLQV ILWMARAAGF GHSWREVAQA GLLTSSEARD LRRAEQAFKR       240
     LRIELHLLTG RREDRVLFDL QPGLAAVYGI ASTATRRASE LLMQRYYWAA RLVTQLNVIL       300
     VQNIEERLFP RPDSDARLID DDFRNLRERL DIVREDGFER NPTLLLRAFL VMQQHPELIG       360
     MSARTLRAIW HSRHRIDAQF RRNPVNRKLF LQILQQPRGI VHELRRMTML NILPRYLPVF       420
     RRIVGQMQHD LFHVYTVDQH TLAVVRNLRR FTMPEHAQEY PLASQLIAGL DRHWLLYVAA       480
     LFHDIAKGRG GDHSELGARE VRRFAQDHGL DPADAELVEF LVRHHLLMSA VAQKRDLSDP       540
     QVVRDFAAQV GDERRLAALY LLTVADIRGT SPRVWNAWKG KLLEDLFRLA LAALGGAHAD       600
     AHTVLTERKD EAARLTRLAG LRDDAREAFW NQLDIAYFLR HDASEIAWHT RHLYYQVAPD       660
     EPVVRVRPTE HGEGLQVMVY TRDAPDLFVT TCGYFDAKSL SVQDARVHTT RHGWALDSFI       720
     VLAPEGFADL RAQATLVEHE LAERLRDPHA ARHAHAPRRL PHSHARRSRV FPVMPQAELS       780
     PDERSQSWRL SVTATDRPGL LYALARVFAE HGVDLIMAKI MTLGERVEDV FIVSGSALER       840
     PRSQMQFERA ILDALAGDEP RQQAA                                             865
//

If you have problems or comments...

PBIL Back to PBIL home page