(data stored in ACNUC1104 zone)

EMBL: BX640427.GLNQ

BX640427.GLNQ        Location/Qualifiers
FT   CDS             276858..277631
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BPP1566"
FT                   /product="glutamine transport ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1855"
FT                   /db_xref="GOA:Q7WA26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA26"
FT                   /protein_id="CAE36868.1"
FT                   /translation="MSTQEMIRIRGLRKAYGEHEVLRGIDFNVEASQVVVVIGPSGSGK
FT                   STLLRCCNGLEVAQGGTIDICGHNLLKDGRLLPEAELNRLRMQVGMVFQGFNLFPHLSV
FT                   LDNVTVGPRTLRGMSRAQAEELGGDLLAKVGLREKMAAMPGSLSGGQKQRVAIARALAM
FT                   QPRVMLFDEPTSALDPELVGEVLQVMKLLAREGMTMMVVTHEMGFAREVADVVAVMDGG
FT                   SIVESGPPELIFSQPREARTRAFLQAVLSASQGAA"
     MSTQEMIRIR GLRKAYGEHE VLRGIDFNVE ASQVVVVIGP SGSGKSTLLR CCNGLEVAQG        60
     GTIDICGHNL LKDGRLLPEA ELNRLRMQVG MVFQGFNLFP HLSVLDNVTV GPRTLRGMSR       120
     AQAEELGGDL LAKVGLREKM AAMPGSLSGG QKQRVAIARA LAMQPRVMLF DEPTSALDPE       180
     LVGEVLQVMK LLAREGMTMM VVTHEMGFAR EVADVVAVMD GGSIVESGPP ELIFSQPREA       240
     RTRAFLQAVL SASQGAA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page