(data stored in ACNUC1104 zone)

EMBL: BX640427.HOLB

BX640427.HOLB        Location/Qualifiers
FT   CDS             271682..272734
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BPP1560"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1848"
FT                   /db_xref="GOA:Q7WA30"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA30"
FT                   /protein_id="CAE36862.1"
FT                   /translation="MSLGRFLPWQTEIARSWLSGRDRFAHAWLIHGNGGIGKLDFAAAA
FT                   AASLLCESPRQGLACGECAACAWVASGNHPDLRRIRPEAVALEEGADQAEGAEEAEAGS
FT                   GGAAAKRAPSKDIRIDQIRALEPWFNTATHRGGWRVALLYPAHALNVISANALLKVLEE
FT                   PPAHTVFLLVADAPDRLLPTLVSRCRRLPLPTPSAGQALQWLGEQGVEPAADWLAAAGG
FT                   APLAAQRLAARGDAPCPAWLAQLVQPLAAGKAPDVGTLTENLEKVAAAEWIDALQRLFT
FT                   DLTLAAHGAASRYYPSLAEPVRQAAARAQPAQLAETARWLSRQRGLATHPLNAKLFVHA
FT                   ALQRVVLSCQ"
     MSLGRFLPWQ TEIARSWLSG RDRFAHAWLI HGNGGIGKLD FAAAAAASLL CESPRQGLAC        60
     GECAACAWVA SGNHPDLRRI RPEAVALEEG ADQAEGAEEA EAGSGGAAAK RAPSKDIRID       120
     QIRALEPWFN TATHRGGWRV ALLYPAHALN VISANALLKV LEEPPAHTVF LLVADAPDRL       180
     LPTLVSRCRR LPLPTPSAGQ ALQWLGEQGV EPAADWLAAA GGAPLAAQRL AARGDAPCPA       240
     WLAQLVQPLA AGKAPDVGTL TENLEKVAAA EWIDALQRLF TDLTLAAHGA ASRYYPSLAE       300
     PVRQAAARAQ PAQLAETARW LSRQRGLATH PLNAKLFVHA ALQRVVLSCQ                  350
//

If you have problems or comments...

PBIL Back to PBIL home page