(data stored in ACNUC1104 zone)

EMBL: BX640427.ILVD

BX640427.ILVD        Location/Qualifiers
FT   CDS             complement(86174..87886)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BPP1380"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="Similar to Mycobacterium tuberculosis dihydroxy-acid
FT                   dehydratase IlvD or Rv0189c or Mt0199 or Mtci28.28C
FT                   SWALL:ILVD_MYCTU (SWALL:O07433) (575 aa) fasta scores: E():
FT                   7.6e-93, 49.01% id in 557 aa, and to Rhizobium loti
FT                   dihydroxyacid dehydratase Mll1102 SWALL:Q98LB3
FT                   (EMBL:AP002996) (586 aa) fasta scores: E(): 8.1e-109,
FT                   56.17% id in 559 aa"
FT                   /db_xref="GOA:Q7WAJ6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ6"
FT                   /protein_id="CAE36682.1"
FT                   /translation="MSLHKHRSRMVTQGLTRTPHRAFLRATGFDDAALEKSMVGIVSTQ
FT                   GENTPCSMALGPQADRARLGVAAGGGVPVSFSTISISDGTSMNHAGMRMSLLSRETIAD
FT                   SVELVVRGHAYDALVAFAGCDKTLPAMMMAIVRLNVPAVFLYSGATLPGHAASGQVTIL
FT                   DTIEAVGRVQHGTMPAAELKAMERTCTPSAGSCPGQFTANTMAMVGEALGLSPLGSAMM
FT                   PAVYSERLAIAQRAGEHVMRALAAGGPLPRQLVTRASLENACAAVAATGGSTNAALHIP
FT                   AIAHEAGIAFTLDDVARVFKRTPLIADLQPGGRYLARDLHEAGGVPVVLKALLDGGHID
FT                   GSVLTLDGRTLAEALADTPAPDGKVVRACGQALHPTGGVAVLKGNLSPDGALLKIAGLK
FT                   SLKFSGPARVFENEEACMRAVSTHAYQPGEVLVIRNEGPRGGPGMREMLSVTAALYGQG
FT                   MGEKVALLTDGRFSGATRGLCIGYAGPEAAAGGPIALLRDGDMIHIDAEADTLDVALSD
FT                   EELARRRAAYQAPPQARLAGALEKYAALVRPACLGAVTHSGQVDWPYETPEAE"
     MSLHKHRSRM VTQGLTRTPH RAFLRATGFD DAALEKSMVG IVSTQGENTP CSMALGPQAD        60
     RARLGVAAGG GVPVSFSTIS ISDGTSMNHA GMRMSLLSRE TIADSVELVV RGHAYDALVA       120
     FAGCDKTLPA MMMAIVRLNV PAVFLYSGAT LPGHAASGQV TILDTIEAVG RVQHGTMPAA       180
     ELKAMERTCT PSAGSCPGQF TANTMAMVGE ALGLSPLGSA MMPAVYSERL AIAQRAGEHV       240
     MRALAAGGPL PRQLVTRASL ENACAAVAAT GGSTNAALHI PAIAHEAGIA FTLDDVARVF       300
     KRTPLIADLQ PGGRYLARDL HEAGGVPVVL KALLDGGHID GSVLTLDGRT LAEALADTPA       360
     PDGKVVRACG QALHPTGGVA VLKGNLSPDG ALLKIAGLKS LKFSGPARVF ENEEACMRAV       420
     STHAYQPGEV LVIRNEGPRG GPGMREMLSV TAALYGQGMG EKVALLTDGR FSGATRGLCI       480
     GYAGPEAAAG GPIALLRDGD MIHIDAEADT LDVALSDEEL ARRRAAYQAP PQARLAGALE       540
     KYAALVRPAC LGAVTHSGQV DWPYETPEAE                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page