(data stored in ACNUC1104 zone)

EMBL: BX640427.ILVG

BX640427.ILVG        Location/Qualifiers
FT   CDS             complement(282928..284661)
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BPP1571"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1860"
FT                   /db_xref="GOA:Q7WA22"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA22"
FT                   /protein_id="CAE36873.1"
FT                   /translation="MTTPALPERNGGQILMQQLRVHGARRVFMIPGESYLPCIDALNEH
FT                   RGAIDAIVCRQESGAAYMAEAYGKLTGEPGICFVTRGPGATNASIGVHTAYQDSTPMIL
FT                   FIGQVGNDFMEREAFQEIDYRRMFGQMAKWVAQIDRTERIPEFIARAFAVATSGRPGPV
FT                   VLALPEDTLWGRARVADMPRYRRARCLPGAADLARMVELLDQAERPFMLLGGTGWSAEA
FT                   IGQAAAFAERFELPVGTAWRRLECFDQRHPNAAGHVGWAMAPELRQRIAGADLVLAVGT
FT                   RMGEATTEGYTVIESPLPRQRLVHAYPDPNELGRVFAPTLGIVADPAGFAAALDALRPG
FT                   HRASRAQAVRAAHDEYLATLAPLPSPGPLNLDSAAAYVNQHIPADACITVGAGNYALYP
FT                   HRYRQFSGPGTSLAPTVGSMGYGLPAAISAKLENPARTVVCYAGDGCFQMNMQELGVAL
FT                   LQELGVALQYRVGVVVLVFNNGIWGTIRAHQEREFPGRAIALDFQNPDFTQFVRAYGGY
FT                   GEAVERTEDFGPAFERARAFAEREQLPALLEIRYEADGIAPGQTLTEIHQAAQAQAAGV
FT                   Q"
     MTTPALPERN GGQILMQQLR VHGARRVFMI PGESYLPCID ALNEHRGAID AIVCRQESGA        60
     AYMAEAYGKL TGEPGICFVT RGPGATNASI GVHTAYQDST PMILFIGQVG NDFMEREAFQ       120
     EIDYRRMFGQ MAKWVAQIDR TERIPEFIAR AFAVATSGRP GPVVLALPED TLWGRARVAD       180
     MPRYRRARCL PGAADLARMV ELLDQAERPF MLLGGTGWSA EAIGQAAAFA ERFELPVGTA       240
     WRRLECFDQR HPNAAGHVGW AMAPELRQRI AGADLVLAVG TRMGEATTEG YTVIESPLPR       300
     QRLVHAYPDP NELGRVFAPT LGIVADPAGF AAALDALRPG HRASRAQAVR AAHDEYLATL       360
     APLPSPGPLN LDSAAAYVNQ HIPADACITV GAGNYALYPH RYRQFSGPGT SLAPTVGSMG       420
     YGLPAAISAK LENPARTVVC YAGDGCFQMN MQELGVALLQ ELGVALQYRV GVVVLVFNNG       480
     IWGTIRAHQE REFPGRAIAL DFQNPDFTQF VRAYGGYGEA VERTEDFGPA FERARAFAER       540
     EQLPALLEIR YEADGIAPGQ TLTEIHQAAQ AQAAGVQ                                577
//

If you have problems or comments...

PBIL Back to PBIL home page