(data stored in ACNUC1104 zone)

EMBL: BX640427.LINM18

BX640427.LINM18      Location/Qualifiers
FT   CDS             115060..115863
FT                   /transl_table=11
FT                   /gene="linM18"
FT                   /locus_tag="BPP1410"
FT                   /product="bacteriocin"
FT                   /note="Similar to Brevibacterium linens bacteriocin linocin
FT                   M18 LinM18 SWALL:Q45296 (EMBL:X93588) (266 aa) fasta
FT                   scores: E(): 9.5e-54, 56.6% id in 265 aa, and to
FT                   Mycobacterium tuberculosis 29 kDa antigen cfp29
FT                   SWALL:O07812 (EMBL:Y12820) (265 aa) fasta scores: E():
FT                   2e-59, 62.5% id in 264 aa"
FT                   /db_xref="GOA:Q7WAG7"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG7"
FT                   /protein_id="CAE36712.1"
FT                   /translation="MNNLYRDLAPISAAAWAQIEEEVARTFKRSVAGRRVVDVKDPGGF
FT                   GLAAVGTGHLRGIAAPQKGVDAKLREVKALVELTVPFELQRDEIDAVERGANDADWQPA
FT                   KDAATELAYAEDRAIFDGYKAAGIVGIREGSSNSRLELPTDAADYPAAVGRALEQLRLA
FT                   GVDGPYSVLLGADAYTALSEGSDDGYPTIDHIKRIVSGDIIWAPALNGGCVLSTRGGDF
FT                   ELHLGQDLSIGYQSHTDKVVRLYLRETLTFLMLTSEASVPVAPKG"
     MNNLYRDLAP ISAAAWAQIE EEVARTFKRS VAGRRVVDVK DPGGFGLAAV GTGHLRGIAA        60
     PQKGVDAKLR EVKALVELTV PFELQRDEID AVERGANDAD WQPAKDAATE LAYAEDRAIF       120
     DGYKAAGIVG IREGSSNSRL ELPTDAADYP AAVGRALEQL RLAGVDGPYS VLLGADAYTA       180
     LSEGSDDGYP TIDHIKRIVS GDIIWAPALN GGCVLSTRGG DFELHLGQDL SIGYQSHTDK       240
     VVRLYLRETL TFLMLTSEAS VPVAPKG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page