(data stored in ACNUC1104 zone)

EMBL: BX640427.LPXA

BX640427.LPXA        Location/Qualifiers
FT   CDS             252618..253412
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BPP1539"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucos
FT                   amine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1431"
FT                   /db_xref="GOA:Q7WA48"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA48"
FT                   /protein_id="CAE36841.1"
FT                   /translation="MSGNIHPTAVVDPAAQIDSSVVIGPYSVVGPGVSIAAGTEVGAHC
FT                   VLDGVTSIGRDNRFYRFCSIGGMPQDKKYSGEPTRLVIGDRNTVREFTTFNTGTVQDGG
FT                   VTSIGDDNWIMAYVHIAHDCHIGNNTILANSVQLGGHVQVGDWAIVGGLTGVHQFAKIG
FT                   AHSMTGSNSSLMQDAPPFVLAAGNPCRPVGVNVEGLKRRGFSAAAISALRDAYKSIYRR
FT                   GLSLDEARAELRARQQAEPDVAEHLQTMLDFLDASTRGIIRP"
     MSGNIHPTAV VDPAAQIDSS VVIGPYSVVG PGVSIAAGTE VGAHCVLDGV TSIGRDNRFY        60
     RFCSIGGMPQ DKKYSGEPTR LVIGDRNTVR EFTTFNTGTV QDGGVTSIGD DNWIMAYVHI       120
     AHDCHIGNNT ILANSVQLGG HVQVGDWAIV GGLTGVHQFA KIGAHSMTGS NSSLMQDAPP       180
     FVLAAGNPCR PVGVNVEGLK RRGFSAAAIS ALRDAYKSIY RRGLSLDEAR AELRARQQAE       240
     PDVAEHLQTM LDFLDASTRG IIRP                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page