(data stored in ACNUC1104 zone)

EMBL: BX640427.MIP

BX640427.MIP         Location/Qualifiers
FT   CDS             111952..112497
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="BPP1405"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Legionella pneumophila Mip SWALL:Q53427
FT                   (EMBL:S71704) (184 aa) fasta scores: E(): 1.7e-22, 44.57%
FT                   id in 175 aa, and to Anabaena sp. hypothetical protein
FT                   Alr7524 SWALL:Q8ZSI6 (EMBL:AP003602) (193 aa) fasta scores:
FT                   E(): 6.8e-10, 30.06% id in 163 aa"
FT                   /db_xref="GOA:Q7WAH2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH2"
FT                   /protein_id="CAE36707.1"
FT                   /translation="MSRVLLIDPSQAGAERQAILAQIQGAFGATPNMFKAVANSAAALK
FT                   SMWEAFGALGGGVIAARLGEQIAVAVANRNRCEYCLAAHTALGRKAGASAGDMAAAQDG
FT                   RSADPRTAAALRFALQLVEARGQVGEAEVQAVRAAGFSDEEIVEILAHVALNLFTNYVN
FT                   VAFAVPVDFPKVALRQAA"
     MSRVLLIDPS QAGAERQAIL AQIQGAFGAT PNMFKAVANS AAALKSMWEA FGALGGGVIA        60
     ARLGEQIAVA VANRNRCEYC LAAHTALGRK AGASAGDMAA AQDGRSADPR TAAALRFALQ       120
     LVEARGQVGE AEVQAVRAAG FSDEEIVEIL AHVALNLFTN YVNVAFAVPV DFPKVALRQA       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page