(data stored in ACNUC1104 zone)

EMBL: BX640427.MOTB

BX640427.MOTB        Location/Qualifiers
FT   CDS             182731..183678
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BPP1470"
FT                   /product="chemotaxis protein MotB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1025"
FT                   /db_xref="GOA:Q7WAB0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB0"
FT                   /protein_id="CAE36772.1"
FT                   /translation="MSTVNNHRVVIRRRKVRRGGHHGGSWKIAYADFITAMMAFFLVMW
FT                   LISIVPREELKGIAEYFRMPLRVALTGGPSSSAETSAIPGGGQDPLRSQGDVRRAEGNR
FT                   VEAQPMGDAERRDRHRLERLKVRLENLIEESPVLKNFRPQLLIDMTTEGLRIQIVDNQN
FT                   RPMFATGSADVQPYMRDILRELGPVLNDLPNKISIAGHTDASQYARGERAYSNWELSAD
FT                   RANASRQELVAGGMHEGKVLRIQGLASSMSLVKDDPFAAVNRRISLVVLNASTQRRIEN
FT                   ENAAAADVNARDAQGVGAALAGQLAASGSDGGAR"
     MSTVNNHRVV IRRRKVRRGG HHGGSWKIAY ADFITAMMAF FLVMWLISIV PREELKGIAE        60
     YFRMPLRVAL TGGPSSSAET SAIPGGGQDP LRSQGDVRRA EGNRVEAQPM GDAERRDRHR       120
     LERLKVRLEN LIEESPVLKN FRPQLLIDMT TEGLRIQIVD NQNRPMFATG SADVQPYMRD       180
     ILRELGPVLN DLPNKISIAG HTDASQYARG ERAYSNWELS ADRANASRQE LVAGGMHEGK       240
     VLRIQGLASS MSLVKDDPFA AVNRRISLVV LNASTQRRIE NENAAAADVN ARDAQGVGAA       300
     LAGQLAASGS DGGAR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page