(data stored in ACNUC1104 zone)

EMBL: BX640427.MRCA

BX640427.MRCA        Location/Qualifiers
FT   CDS             complement(344285..346969)
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /gene_synonym="ponA"
FT                   /locus_tag="BPP1631"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.2.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0905"
FT                   /db_xref="GOA:Q7W9W8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9W8"
FT                   /protein_id="CAE36932.1"
FT                   /translation="MHVWLRKPIPPDAGLWCSALESAPMNTSSQSTKPPPPGGPRLFRK
FT                   SLLIKAGVAVAGLGAAGALALGLALALAWPSLPELHAMTDYRPRVPLRVYTADGVLIGE
FT                   FGEEHRNVLRADEIPQVMKQAVLAAEDDRFYQHGGVDWMGVARAVLTNMVKLSKSQGGS
FT                   TITMQVARNFYLSSEKTYSRKFYELLLTYKIEAELTKDQILELYMNQTYLGHRSYGFAA
FT                   ASRTYFGKPLSEVTPAEAAMLAGIPKAPSRANPLASLPRATARQQYVLGRMQTLGYLTP
FT                   EQVQEARAQTIVLRGSEGGPAHGFAIHGEYPAELVRQLMYSIYQDGAYTHGIDVYTTID
FT                   SKAQQAAYRAVRAGVLDYTRRAPYPGPQAQIDLPDGIEQDAQAFDEILDSVQDQAPDSD
FT                   DLLAGVVLSASPTSVTVARTATDIVTVDDKKALAIVARALAPNAKDALRIRRGSVVYLH
FT                   KNGDTWEIINMPALQAALVSMSPADGAISAMIGGFDFHRGSFNRVTQAWRQPGSTIKPF
FT                   VYAAALERGMTPATQVNDQPFMLTAEQTGSRAWQPKNDGNRYEPMLTLREGLYRSKNMV
FT                   SIRILQAIGPEYARDYLTRFGFEQARWPAVLPLALGAGGATPLQVANAYSVFANGGYRV
FT                   TPYLIDRVTDRSGKVLMQTTPVKAGDETARAIDPRTAWVIDDIMHDTTTKGTAARVYRT
FT                   LKRNDIAGKTGTTNDAVDVWFSGYTAQQTTTVWMGFDQPRSLGTNEFGSGLALSTWLDY
FT                   EQPTLKGTPQAPRAPRPQGLIVDNSEYYFSEFPPGQAVAALDLSSGDELTDFLNNMRPS
FT                   DGAPARVQQPGQPPAGSSSGGQPPIPPIPVPRADLPDGQATPASLPLGAPPAAASAPPA
FT                   APAHGGASAQPVTLPGRVGATPL"
     MHVWLRKPIP PDAGLWCSAL ESAPMNTSSQ STKPPPPGGP RLFRKSLLIK AGVAVAGLGA        60
     AGALALGLAL ALAWPSLPEL HAMTDYRPRV PLRVYTADGV LIGEFGEEHR NVLRADEIPQ       120
     VMKQAVLAAE DDRFYQHGGV DWMGVARAVL TNMVKLSKSQ GGSTITMQVA RNFYLSSEKT       180
     YSRKFYELLL TYKIEAELTK DQILELYMNQ TYLGHRSYGF AAASRTYFGK PLSEVTPAEA       240
     AMLAGIPKAP SRANPLASLP RATARQQYVL GRMQTLGYLT PEQVQEARAQ TIVLRGSEGG       300
     PAHGFAIHGE YPAELVRQLM YSIYQDGAYT HGIDVYTTID SKAQQAAYRA VRAGVLDYTR       360
     RAPYPGPQAQ IDLPDGIEQD AQAFDEILDS VQDQAPDSDD LLAGVVLSAS PTSVTVARTA       420
     TDIVTVDDKK ALAIVARALA PNAKDALRIR RGSVVYLHKN GDTWEIINMP ALQAALVSMS       480
     PADGAISAMI GGFDFHRGSF NRVTQAWRQP GSTIKPFVYA AALERGMTPA TQVNDQPFML       540
     TAEQTGSRAW QPKNDGNRYE PMLTLREGLY RSKNMVSIRI LQAIGPEYAR DYLTRFGFEQ       600
     ARWPAVLPLA LGAGGATPLQ VANAYSVFAN GGYRVTPYLI DRVTDRSGKV LMQTTPVKAG       660
     DETARAIDPR TAWVIDDIMH DTTTKGTAAR VYRTLKRNDI AGKTGTTNDA VDVWFSGYTA       720
     QQTTTVWMGF DQPRSLGTNE FGSGLALSTW LDYEQPTLKG TPQAPRAPRP QGLIVDNSEY       780
     YFSEFPPGQA VAALDLSSGD ELTDFLNNMR PSDGAPARVQ QPGQPPAGSS SGGQPPIPPI       840
     PVPRADLPDG QATPASLPLG APPAAASAPP AAPAHGGASA QPVTLPGRVG ATPL             894
//

If you have problems or comments...

PBIL Back to PBIL home page