(data stored in ACNUC1104 zone)

EMBL: BX640427.NORM

BX640427.NORM        Location/Qualifiers
FT   CDS             complement(73015..74397)
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="BPP1367"
FT                   /product="multidrug resistance protein"
FT                   /note="Similar to Escherichia coli multidrug resistance
FT                   protein NorM or B1663 SWALL:NORM_ECOLI (SWALL:P37340) (457
FT                   aa) fasta scores: E(): 7.9e-41, 33.92% id in 451 aa, and to
FT                   Rhizobium loti multidrug efflux protein, NorM Mll4906
FT                   SWALL:Q98D15 (EMBL:AP003005) (467 aa) fasta scores: E():
FT                   3e-101, 59.1% id in 445 aa"
FT                   /db_xref="GOA:Q7WAK9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAK9"
FT                   /protein_id="CAE36669.1"
FT                   /translation="MPRSTARAAWKRELAATLALGLPLVLTNLAQMAMTVTDVIFIGRL
FT                   GSQALAASALGANLFTAIEFFGLGLVAATAPMVAHALGRRGNTVRDVRRTVRQGLWTAV
FT                   IYSVPGCLLLWHGEAILLAIDQPPELAAQAGAYLRALMWAMPPFLGFLVLRSFVTALQR
FT                   PRSAFLIALAAIVLNVFGNWVLVFGNLGAPALGLVGAGLASALATLGLFLGMVGVVCLD
FT                   RRFRRYHLFGDVWQPDWQRLAEFWKLGLPIGAATAFEVTIFNAAAFLMGWLGEPELAAH
FT                   AIAIQIASVTFMIPYGIAQAATVRVGHAYGARQPDQVARAGWCAFSLGIGSMAIAAALM
FT                   LLAPGLLVSAFLDIGDPANAQVLRLATAYLAVAALFQIVDGAQVLGAGMLRGLHDTRVP
FT                   MLYAALGYWGVGLPSGAALAFWAGWRGVGVWSGLAIGLALVAVLMMQRWLRRDRVGLLR
FT                   RA"
     MPRSTARAAW KRELAATLAL GLPLVLTNLA QMAMTVTDVI FIGRLGSQAL AASALGANLF        60
     TAIEFFGLGL VAATAPMVAH ALGRRGNTVR DVRRTVRQGL WTAVIYSVPG CLLLWHGEAI       120
     LLAIDQPPEL AAQAGAYLRA LMWAMPPFLG FLVLRSFVTA LQRPRSAFLI ALAAIVLNVF       180
     GNWVLVFGNL GAPALGLVGA GLASALATLG LFLGMVGVVC LDRRFRRYHL FGDVWQPDWQ       240
     RLAEFWKLGL PIGAATAFEV TIFNAAAFLM GWLGEPELAA HAIAIQIASV TFMIPYGIAQ       300
     AATVRVGHAY GARQPDQVAR AGWCAFSLGI GSMAIAAALM LLAPGLLVSA FLDIGDPANA       360
     QVLRLATAYL AVAALFQIVD GAQVLGAGML RGLHDTRVPM LYAALGYWGV GLPSGAALAF       420
     WAGWRGVGVW SGLAIGLALV AVLMMQRWLR RDRVGLLRRA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page