(data stored in ACNUC1104 zone)

EMBL: BX640427.PCKG

BX640427.PCKG        Location/Qualifiers
FT   CDS             74585..76441
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /gene_synonym="pck"
FT                   /locus_tag="BPP1368"
FT                   /product="phosphoenolpyruvate carboxykinase [GTP]"
FT                   /EC_number="4.1.1.32"
FT                   /note="Similar to Mycobacterium smegmatis
FT                   phosphoenolpyruvate carboxykinase [GTP] PckG or Pck
FT                   SWALL:PPCK_MYCSM (SWALL:Q9AGJ6) (605 aa) fasta scores: E():
FT                   3.7e-152, 59.59% id in 599 aa, and to Ralstonia
FT                   solanacearum probable phosphoenolpyruvate carboxykinase
FT                   protein pckA or Rsc0017 or Rs01839 SWALL:Q8Y3G3
FT                   (EMBL:AL646057) (622 aa) fasta scores: E(): 1.4e-210,
FT                   79.67% id in 620 aa"
FT                   /db_xref="GOA:Q7WAK8"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAK8"
FT                   /protein_id="CAE36670.1"
FT                   /translation="MNKPSEVKPVALNVPDYVKHSGLIAWVERIAALTKPDRVVWCDGS
FT                   QEEYDRLCEQMVQGGTMRRLNPAKRANSYLACSDPSDVARVEDRTFICSEREEDAGPTN
FT                   NWAAPQAMRETLGGLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIM
FT                   TRMGRKVFDVLGSDGAFVPCVHSVGMPLAEGQQDVAWPCNPTKYIVHYPETREIWSFGS
FT                   GYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPKGRKYHVAAAFPSACGKTN
FT                   FAMLIPPHGMDGWKVTTIGDDIAWIKPGPDGRLHAINPEAGYFGVAPGTSEKTNFNAMA
FT                   MLKANVIFTNVALTDDGDVWWEGMTDTPPAHLIDWQGQDWTPAIAAETGRKAAHPNARF
FT                   TAPAAQCPSIDPEWENPKGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETT
FT                   AAAAGQQGVVRRDPFAMLPFCGYNMSDYFDHWLKLGRRLEETGATLPRIYCVNWFRKGP
FT                   DGKFVWPGFGENMRVLRWMLGRLDGQAGGVDQVFGISPAYGDIDWTGLEFSPDKFEQVI
FT                   SVDLPAWRAELALHDELFTQLAARLPEDLPLTRTAIERRMAA"
     MNKPSEVKPV ALNVPDYVKH SGLIAWVERI AALTKPDRVV WCDGSQEEYD RLCEQMVQGG        60
     TMRRLNPAKR ANSYLACSDP SDVARVEDRT FICSEREEDA GPTNNWAAPQ AMRETLGGLF       120
     DGAMRGRTMY VVPFSMGPLG SPIAHIGVEL SDSPYVVVNM RIMTRMGRKV FDVLGSDGAF       180
     VPCVHSVGMP LAEGQQDVAW PCNPTKYIVH YPETREIWSF GSGYGGNALL GKKCFALRIA       240
     STMGRDEGWL AEHMLILGVT SPKGRKYHVA AAFPSACGKT NFAMLIPPHG MDGWKVTTIG       300
     DDIAWIKPGP DGRLHAINPE AGYFGVAPGT SEKTNFNAMA MLKANVIFTN VALTDDGDVW       360
     WEGMTDTPPA HLIDWQGQDW TPAIAAETGR KAAHPNARFT APAAQCPSID PEWENPKGVA       420
     IDAFIFGGRR STTVPLVTEA RNWVEGVYMA ATMGSETTAA AAGQQGVVRR DPFAMLPFCG       480
     YNMSDYFDHW LKLGRRLEET GATLPRIYCV NWFRKGPDGK FVWPGFGENM RVLRWMLGRL       540
     DGQAGGVDQV FGISPAYGDI DWTGLEFSPD KFEQVISVDL PAWRAELALH DELFTQLAAR       600
     LPEDLPLTRT AIERRMAA                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page