(data stored in ACNUC1104 zone)

EMBL: BX640427.PE1

BX640427.PE1         Location/Qualifiers
FT   CDS             80..703
FT                   /transl_table=11
FT                   /locus_tag="BPP1292"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2598"
FT                   /db_xref="GOA:Q7WAS6"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS6"
FT                   /protein_id="CAE36594.1"
FT                   /translation="MYLPAHFAETRPEELARIIRAHPLGMLVTQDAQGLDADHLPFEFD
FT                   PDAGPHGTLIAHVARANTLWQRCPDGAAVMVVFRGAEGYISPNWYPSKHEAHRQVPTWN
FT                   YEVVHAHGTLAVRDDERFVRGVVARLTRRHEAGESRPWKMTDSTPEYIDSMLRNIVGIE
FT                   VAITSLVGKRKLSQNKDERDRLGAVQALQARGQDALAQSMARAE"
     MYLPAHFAET RPEELARIIR AHPLGMLVTQ DAQGLDADHL PFEFDPDAGP HGTLIAHVAR        60
     ANTLWQRCPD GAAVMVVFRG AEGYISPNWY PSKHEAHRQV PTWNYEVVHA HGTLAVRDDE       120
     RFVRGVVARL TRRHEAGESR PWKMTDSTPE YIDSMLRNIV GIEVAITSLV GKRKLSQNKD       180
     ERDRLGAVQA LQARGQDALA QSMARAE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page