(data stored in ACNUC1104 zone)

EMBL: BX640427.PE10

BX640427.PE10        Location/Qualifiers
FT   CDS             9927..10451
FT                   /transl_table=11
FT                   /locus_tag="BPP1301"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2589"
FT                   /db_xref="GOA:Q7WAR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR8"
FT                   /protein_id="CAE36603.1"
FT                   /translation="MEYLFTLKYQLADADSDLDPLVERLGQAGCDDALVGMGLPGRLAL
FT                   EFTREADSAEAAVRSALADVRRAMPTAALIEAAPDLVGLTDVAQIVGVSRQNMRKLMLA
FT                   HPATFPAPIHEGSASLWHLADVLGWLQARGGYPLAQATLDVARMALKVNVAKEARRLPR
FT                   SAGAGLDALVG"
     MEYLFTLKYQ LADADSDLDP LVERLGQAGC DDALVGMGLP GRLALEFTRE ADSAEAAVRS        60
     ALADVRRAMP TAALIEAAPD LVGLTDVAQI VGVSRQNMRK LMLAHPATFP APIHEGSASL       120
     WHLADVLGWL QARGGYPLAQ ATLDVARMAL KVNVAKEARR LPRSAGAGLD ALVG             174
//

If you have problems or comments...

PBIL Back to PBIL home page