(data stored in ACNUC1104 zone)

EMBL: BX640427.PE101

BX640427.PE101       Location/Qualifiers
FT   CDS             99716..100456
FT                   /transl_table=11
FT                   /locus_tag="BPP1392"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Similar to Bacillus subtilis 3-oxoacyl-[acyl-carrier
FT                   protein] reductase FabG SWALL:FABG_BACSU (SWALL:P51831)
FT                   (246 aa) fasta scores: E(): 1.1e-27, 42.91% id in 240 aa,
FT                   and to Pseudomonas aeruginosa probable short-chain
FT                   dehydrogenase Pa1470 SWALL:Q9I3P2 (EMBL:AE004576) (245 aa)
FT                   fasta scores: E(): 5.5e-57, 71.6% id in 243 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI5"
FT                   /protein_id="CAE36694.1"
FT                   /translation="MNMDISKAAIVTGGSRGIGRAIAARLAADGFAVVVNYAGNGAKAH
FT                   ATVAAIESAGGKAIAIQGDVGKPQDVANLFAQARAAFGRIDVVVNSAGVMPMASIDAAN
FT                   LDAFDQVIATNLRGAFLVLAQAAANLGDDGRIIALSTSVIAKSLPGYGPYIASKAGVEG
FT                   LVHVLANELRGRNITVNAIAPGPVGTDLFFNGKSEEAVASIARQAPMERIGMPDEIAAA
FT                   VSFLAGPDGRWVNAQVLRVNGGFA"
     MNMDISKAAI VTGGSRGIGR AIAARLAADG FAVVVNYAGN GAKAHATVAA IESAGGKAIA        60
     IQGDVGKPQD VANLFAQARA AFGRIDVVVN SAGVMPMASI DAANLDAFDQ VIATNLRGAF       120
     LVLAQAAANL GDDGRIIALS TSVIAKSLPG YGPYIASKAG VEGLVHVLAN ELRGRNITVN       180
     AIAPGPVGTD LFFNGKSEEA VASIARQAPM ERIGMPDEIA AAVSFLAGPD GRWVNAQVLR       240
     VNGGFA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page