(data stored in ACNUC1104 zone)

EMBL: BX640427.PE102

BX640427.PE102       Location/Qualifiers
FT   CDS             complement(100588..101361)
FT                   /transl_table=11
FT                   /locus_tag="BPP1393"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Salmonella typhi putative lipoprotein
FT                   Sty0979 SWALL:Q8Z804 (EMBL:AL627268) (253 aa) fasta scores:
FT                   E(): 3.5e-46, 53.3% id in 257 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0277 SWALL:Q9I6L3
FT                   (EMBL:AE004465) (252 aa) fasta scores: E(): 2.3e-50, 55.85%
FT                   id in 256 aa"
FT                   /db_xref="GOA:Q7WAI4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI4"
FT                   /protein_id="CAE36695.1"
FT                   /translation="MMKSKTKLLGGALAASLLLAGCASMKSMDTNSLLSAGSDMAKAAN
FT                   LSDADIIQLSDAACKQSDQESKIAPAGNKYSVRLTKLMRGFGNMTLNGQKVNYKVYMTE
FT                   DVNAWAMGNGCVRVYTGLMDLMNDDELRGVIGHEMGHVALGHTKKAMQTAYAVSAARQA
FT                   AGAAGNSVVASLSASQLGEMTEKFINAQFSQSQETAADDFSFDLLTEKKMNRKGLVTAF
FT                   QKLAELDGGESSMFSSHPSSPDRAARMEKRLQAGK"
     MMKSKTKLLG GALAASLLLA GCASMKSMDT NSLLSAGSDM AKAANLSDAD IIQLSDAACK        60
     QSDQESKIAP AGNKYSVRLT KLMRGFGNMT LNGQKVNYKV YMTEDVNAWA MGNGCVRVYT       120
     GLMDLMNDDE LRGVIGHEMG HVALGHTKKA MQTAYAVSAA RQAAGAAGNS VVASLSASQL       180
     GEMTEKFINA QFSQSQETAA DDFSFDLLTE KKMNRKGLVT AFQKLAELDG GESSMFSSHP       240
     SSPDRAARME KRLQAGK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page