(data stored in ACNUC1104 zone)

EMBL: BX640427.PE104

BX640427.PE104       Location/Qualifiers
FT   CDS             102185..103378
FT                   /transl_table=11
FT                   /locus_tag="BPP1395"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable multidrug
FT                   transport transmembrane protein Rsp0429 or Rs00888
FT                   SWALL:Q8XSN8 (EMBL:AL646078) (399 aa) fasta scores: E():
FT                   3.8e-84, 60.93% id in 384 aa, and to Rhizobium loti
FT                   hypothetical protein Mlr8412 SWALL:Q983A8 (EMBL:AP003014)
FT                   (405 aa) fasta scores: E(): 1e-54, 43.52% id in 386 aa"
FT                   /db_xref="GOA:Q7WAI2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI2"
FT                   /protein_id="CAE36697.1"
FT                   /translation="MPSRSAQSSSNVLRLAAAQALAGANTTVVYATAAIIGEALAPSKS
FT                   LATLPISVFVVGMAASTLPAGAVAQRHGRRAAFMLGTLCGVLLGLLAALGIYLESFALF
FT                   CAAMAFGGAYAAVVLTFRFAAAECVEPHRKARALSTVLAGGVLAGVLGPQLVSYTMDAW
FT                   SGHVFAGTYLAASAVAVLAAVVLGGVDLPRPARAAAAGGRPLRVIARQPRFIAAVVCGV
FT                   VTYMLMNFLMTSAPLAMRMHGLSQHASNLGVQWHVIAMYAPSFVAGGLITRHGAVPVVA
FT                   AGLLLTAAAAVVGLAGMDAWHFWVSLTLLGVGWNFGFAGASAMVLECHLPQERTRVQAA
FT                   NDFIIFGTMVVGSFVSGDLLMRYGWEVVCWLALPPLAVAAFALRWFKPLPAGAAGRA"
     MPSRSAQSSS NVLRLAAAQA LAGANTTVVY ATAAIIGEAL APSKSLATLP ISVFVVGMAA        60
     STLPAGAVAQ RHGRRAAFML GTLCGVLLGL LAALGIYLES FALFCAAMAF GGAYAAVVLT       120
     FRFAAAECVE PHRKARALST VLAGGVLAGV LGPQLVSYTM DAWSGHVFAG TYLAASAVAV       180
     LAAVVLGGVD LPRPARAAAA GGRPLRVIAR QPRFIAAVVC GVVTYMLMNF LMTSAPLAMR       240
     MHGLSQHASN LGVQWHVIAM YAPSFVAGGL ITRHGAVPVV AAGLLLTAAA AVVGLAGMDA       300
     WHFWVSLTLL GVGWNFGFAG ASAMVLECHL PQERTRVQAA NDFIIFGTMV VGSFVSGDLL       360
     MRYGWEVVCW LALPPLAVAA FALRWFKPLP AGAAGRA                                397
//

If you have problems or comments...

PBIL Back to PBIL home page