(data stored in ACNUC1104 zone)

EMBL: BX640427.PE105

BX640427.PE105       Location/Qualifiers
FT   CDS             complement(103385..104296)
FT                   /transl_table=11
FT                   /locus_tag="BPP1396"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa2469 SWALL:Q9I113
FT                   (EMBL:AE004674) (304 aa) fasta scores: E(): 2.3e-38, 38.25%
FT                   id in 298 aa, and to Salmonella typhimurium, and Salmonella
FT                   typhi putative transcriptional regulator, LysR family
FT                   Stm2180 or Sty2410 SWALL:Q8XG81 (EMBL:AE008797) (302 aa)
FT                   fasta scores: E(): 1.2e-33, 37.74% id in 302 aa"
FT                   /db_xref="GOA:Q7WAI1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI1"
FT                   /protein_id="CAE36698.1"
FT                   /translation="MLTNWIDRLRPRHLRLLIRLCETGNLTEVAIEYGISQPALSKWLK
FT                   DLEADIGQRLFVREPRGVTPTACARELQAHARAIIGRLERARTAVDHIASGFAGHLSVG
FT                   FSPVVGPVVLPESIRRFRAAYPDVLVSVIEASIDLLLPGLRNGDFDIVVGRLEEVAMPE
FT                   DVRCETLYDEPVCLVAGRAHPLAGRRRISWEDAQAYPWISPQQGTPLRMRLEMELAVAG
FT                   QPLPRHAVESTSVQTNVALLDRSDMIAPMSRRLAEHFQRQGVLRILPLTLGSGGPIGML
FT                   WRADGVHGTHTAHFIACLRQAV"
     MLTNWIDRLR PRHLRLLIRL CETGNLTEVA IEYGISQPAL SKWLKDLEAD IGQRLFVREP        60
     RGVTPTACAR ELQAHARAII GRLERARTAV DHIASGFAGH LSVGFSPVVG PVVLPESIRR       120
     FRAAYPDVLV SVIEASIDLL LPGLRNGDFD IVVGRLEEVA MPEDVRCETL YDEPVCLVAG       180
     RAHPLAGRRR ISWEDAQAYP WISPQQGTPL RMRLEMELAV AGQPLPRHAV ESTSVQTNVA       240
     LLDRSDMIAP MSRRLAEHFQ RQGVLRILPL TLGSGGPIGM LWRADGVHGT HTAHFIACLR       300
     QAV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page