(data stored in ACNUC1104 zone)

EMBL: BX640427.PE106

BX640427.PE106       Location/Qualifiers
FT   CDS             104423..106009
FT                   /transl_table=11
FT                   /locus_tag="BPP1397"
FT                   /product="probable sulfatase"
FT                   /note="Similar to Burkholderia caryophylli phosphonate
FT                   monoester hydrolase PehA SWALL:Q45087 (EMBL:U44852) (514
FT                   aa) fasta scores: E(): 2.1e-13, 28.98% id in 552 aa, and to
FT                   Pseudomonas aeruginosa probable sulfatase Pa2333
FT                   SWALL:Q9I1E5 (EMBL:AE004659) (538 aa) fasta scores: E():
FT                   1.7e-09, 31.65% id in 537 aa"
FT                   /db_xref="GOA:Q7WAI0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI0"
FT                   /protein_id="CAE36699.1"
FT                   /translation="MSQPNFLLFITDQHRADHLGAYGNSQIRTPALDALARRGWLAERF
FT                   YVASPICMPNRATLMTGRMPSAHGARHNGIPLSQRATTFVERLRQAGYGTALVGKSHLQ
FT                   NMTGNGPVWPRPQDPPAEGEAWAPEPGDYDQEWGPLWREDPAHDLATPFYGFSQVDLAV
FT                   DHGDRVWGHYWRWLQREHPEVAAQAGPDHALPAPGFELVRAGQAWRTRVPESCSTTAYL
FT                   GRRTMQALDGYAQRGQPFFIQCSFPDPHHPFTPPGKYWDMYRPEDVELPASFHASAAAG
FT                   RQPPPHVQWMYAQRDSGRAVKHTPAMFACTEREAREAIALNYGSISHIDHTVGEVLAHL
FT                   QRLGLADNTVVIFTSDHGDYLGDHQLLWKGPVHYQSVIRTPFIWADPAGAQGARSDALC
FT                   STTDIAPTILARAGLLPYNGIQGADLGALMRGEQAAPREAVLIEEEGQRVMFGFDKRVR
FT                   MRTLQTGRYRMSVYHGVSWGELYDLREDPLELRNLWDEPGSAALRQDLLFQLAQNLIGH
FT                   GETSPHPTALA"
     MSQPNFLLFI TDQHRADHLG AYGNSQIRTP ALDALARRGW LAERFYVASP ICMPNRATLM        60
     TGRMPSAHGA RHNGIPLSQR ATTFVERLRQ AGYGTALVGK SHLQNMTGNG PVWPRPQDPP       120
     AEGEAWAPEP GDYDQEWGPL WREDPAHDLA TPFYGFSQVD LAVDHGDRVW GHYWRWLQRE       180
     HPEVAAQAGP DHALPAPGFE LVRAGQAWRT RVPESCSTTA YLGRRTMQAL DGYAQRGQPF       240
     FIQCSFPDPH HPFTPPGKYW DMYRPEDVEL PASFHASAAA GRQPPPHVQW MYAQRDSGRA       300
     VKHTPAMFAC TEREAREAIA LNYGSISHID HTVGEVLAHL QRLGLADNTV VIFTSDHGDY       360
     LGDHQLLWKG PVHYQSVIRT PFIWADPAGA QGARSDALCS TTDIAPTILA RAGLLPYNGI       420
     QGADLGALMR GEQAAPREAV LIEEEGQRVM FGFDKRVRMR TLQTGRYRMS VYHGVSWGEL       480
     YDLREDPLEL RNLWDEPGSA ALRQDLLFQL AQNLIGHGET SPHPTALA                    528
//

If you have problems or comments...

PBIL Back to PBIL home page