(data stored in ACNUC1104 zone)

EMBL: BX640427.PE107

BX640427.PE107       Location/Qualifiers
FT   CDS             106051..107028
FT                   /transl_table=11
FT                   /locus_tag="BPP1398"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   9.3e-35, 39.75% id in 322 aa, and to Rhizobium meliloti
FT                   hypothetical protein Ra1058 or Sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 4.5e-37, 38.67%
FT                   id in 331 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH9"
FT                   /protein_id="CAE36700.1"
FT                   /translation="MRIFQALRHAALAAALSLGAAAAATAAYPDKPVRLVVNFTPAGPL
FT                   DLLARLVAERASRELGQTVIVENRAGAGGNIGADVVAKSAPDGYTLLITTDTLATVNPF
FT                   VYASMPADPFKDLQPVALTGTFNQVLVVQPSLGVRNLADYMAYLRQHGGTYASAGNATP
FT                   GHLTFESLRQALDLDVTHVPYRGTAPAVNDLLGGQVEAGFLVVPGVLQHIQAGKLVPLA
FT                   VSGAQRDAALPDVPTIAESGLAQVRDFDTSFGYLLMAPAGVPDEAVQAWQRVLARIYAS
FT                   PEFLERLAALDIAPTFGDAQQAAQWMRTRAARWEKVVAAAGIKP"
     MRIFQALRHA ALAAALSLGA AAAATAAYPD KPVRLVVNFT PAGPLDLLAR LVAERASREL        60
     GQTVIVENRA GAGGNIGADV VAKSAPDGYT LLITTDTLAT VNPFVYASMP ADPFKDLQPV       120
     ALTGTFNQVL VVQPSLGVRN LADYMAYLRQ HGGTYASAGN ATPGHLTFES LRQALDLDVT       180
     HVPYRGTAPA VNDLLGGQVE AGFLVVPGVL QHIQAGKLVP LAVSGAQRDA ALPDVPTIAE       240
     SGLAQVRDFD TSFGYLLMAP AGVPDEAVQA WQRVLARIYA SPEFLERLAA LDIAPTFGDA       300
     QQAAQWMRTR AARWEKVVAA AGIKP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page