(data stored in ACNUC1104 zone)

EMBL: BX640427.PE113

BX640427.PE113       Location/Qualifiers
FT   CDS             complement(110972..111814)
FT                   /transl_table=11
FT                   /locus_tag="BPP1404"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /note="Similar to Xylella fastidiosa transcriptional
FT                   regulator Xf1254 SWALL:Q9PDX5 (EMBL:AE003959) (280 aa)
FT                   fasta scores: E(): 5.5e-44, 45.98% id in 274 aa, and to
FT                   Agrobacterium tumefaciens transcriptional regulator, AraC
FT                   family Atu4575 or Agr_l_593 SWALL:Q8U779 (EMBL:AE009385)
FT                   (321 aa) fasta scores: E(): 4.1e-15, 31.37% id in 290 aa"
FT                   /db_xref="GOA:Q7WAH3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH3"
FT                   /protein_id="CAE36706.1"
FT                   /translation="MDRLSALLERFRVRTALLHAGTLCGHHRFEAQPGRAFLHVLRRGD
FT                   MEVRHRPGETALPRLRLAEPTLLFYPRPLHHEFINPPAEGPDLTCATLDFEGGDRHPLV
FT                   RSLPPVVCVPLDAVAGLRPALDLLFAEADQVRCGSRVLADRLFEVVLIQLLRWMLDHPA
FT                   QVGVSNGLIMGLSDPRLAKALAALHGAPGQAWPLTRMADIAGMSRSAFAAAFKTATGVT
FT                   PAAYLADWRLSLAASMLRAGHPMKRIAPELGFAGVPALSKAFRQRMGASARQWLDAQR"
     MDRLSALLER FRVRTALLHA GTLCGHHRFE AQPGRAFLHV LRRGDMEVRH RPGETALPRL        60
     RLAEPTLLFY PRPLHHEFIN PPAEGPDLTC ATLDFEGGDR HPLVRSLPPV VCVPLDAVAG       120
     LRPALDLLFA EADQVRCGSR VLADRLFEVV LIQLLRWMLD HPAQVGVSNG LIMGLSDPRL       180
     AKALAALHGA PGQAWPLTRM ADIAGMSRSA FAAAFKTATG VTPAAYLADW RLSLAASMLR       240
     AGHPMKRIAP ELGFAGVPAL SKAFRQRMGA SARQWLDAQR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page