(data stored in ACNUC1104 zone)

EMBL: BX640427.PE116

BX640427.PE116       Location/Qualifiers
FT   CDS             113095..113382
FT                   /transl_table=11
FT                   /locus_tag="BPP1407"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 7.8
FT                   kDa protein Sc10f4.38C SWALL:Q9F3M3 (EMBL:AL450350) (69 aa)
FT                   fasta scores: E(): 5.2e-13, 57.81% id in 64 aa, and to
FT                   Streptomyces coelicolor hypothetical 9.9 kDa protein
FT                   Scf43a.35C SWALL:Q9XA80 (EMBL:AL096837) (88 aa) fasta
FT                   scores: E(): 0.00075, 29.07% id in 86 aa"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH0"
FT                   /protein_id="CAE36709.1"
FT                   /translation="MREARPRAGRAFATGGDGMTGKTAFRIGDHVAWNSEAGQVSGTII
FT                   AIHTRDFDYKGHTHRASPDHPQYEIKSDKTDHIAAHRGEVLRRVRAKGGA"
     MREARPRAGR AFATGGDGMT GKTAFRIGDH VAWNSEAGQV SGTIIAIHTR DFDYKGHTHR        60
     ASPDHPQYEI KSDKTDHIAA HRGEVLRRVR AKGGA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page