(data stored in ACNUC1104 zone)

EMBL: BX640427.PE117

BX640427.PE117       Location/Qualifiers
FT   CDS             113379..113939
FT                   /transl_table=11
FT                   /locus_tag="BPP1408"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor conserved
FT                   hypothetical protein Sc10f4.37C SWALL:Q9F3M4
FT                   (EMBL:AL450350) (178 aa) fasta scores: E(): 7e-24, 44.25%
FT                   id in 174 aa, and to Aeropyrum pernix hypothetical protein
FT                   Ape2246 SWALL:Q9Y9P2 (EMBL:AP000064) (188 aa) fasta scores:
FT                   E(): 8.2e-19, 45.16% id in 155 aa"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG9"
FT                   /protein_id="CAE36710.1"
FT                   /translation="MRPPFHTIGHSNRSLEAFVALLEAAGIELVVDIRTVPRSRANPQF
FT                   NQDALPGSLDGRGIAYEHLAALGGLRPRSRTVPREVNGYWDNDSFHNYADYALSQAFYA
FT                   GLEHLVARGRAQRSAVMCSEAVWWRCHRRIVADHLLARGETVFHIMEAGRIDPASLTPG
FT                   ALVRPDGMVVYPGADAAVRPPMP"
     MRPPFHTIGH SNRSLEAFVA LLEAAGIELV VDIRTVPRSR ANPQFNQDAL PGSLDGRGIA        60
     YEHLAALGGL RPRSRTVPRE VNGYWDNDSF HNYADYALSQ AFYAGLEHLV ARGRAQRSAV       120
     MCSEAVWWRC HRRIVADHLL ARGETVFHIM EAGRIDPASL TPGALVRPDG MVVYPGADAA       180
     VRPPMP                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page