(data stored in ACNUC1104 zone)

EMBL: BX640427.PE118

BX640427.PE118       Location/Qualifiers
FT   CDS             114017..115063
FT                   /transl_table=11
FT                   /locus_tag="BPP1409"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Zymomonas mobilis hypothetical 36.5 kDa
FT                   protein SWALL:Q9RH20 (EMBL:AF088897) (322 aa) fasta scores:
FT                   E(): 2.1e-70, 57.84% id in 306 aa, and to Mycobacterium
FT                   tuberculosis hypothetical protein Rv0799c or Mtcy07h7a.10
FT                   or Mtci429b.01 or Mt0820 SWALL:O07180 (EMBL:Z96797) (335
FT                   aa) fasta scores: E(): 6.9e-70, 56.56% id in 343 aa"
FT                   /db_xref="GOA:Q7WAG8"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG8"
FT                   /protein_id="CAE36711.1"
FT                   /translation="MPQNNPEPQAVVSPITRSAIFLVATVGADNEAADKVRALCGKLAD
FT                   LARAVGKRVPAGNLSCVCGFSAAGWDRLFGQPRPAELHPFREFSAGERRAPATPGDLLL
FT                   HIRAEQMDLCFELATHVMAQLGDAVTVVDEVHGFRYFDLRSMVGFVDGTENPTGREALD
FT                   FTLVDDADPDFAGGSYVLVQKYLHDMDGWNALSVETQERIIGRTKLSDIELDEAVKPSN
FT                   SHSALTTLEENGQEIKILRDNMPFGRPGSGEFGTYFIGYARSPAPIEQMLENMVVGRPP
FT                   GNYDRLLDFSRAVTGGLFFAPSADLLEALAERDPQDTDGSRLDPAPAARAPHDGSLNIG
FT                   SLKGNPQQ"
     MPQNNPEPQA VVSPITRSAI FLVATVGADN EAADKVRALC GKLADLARAV GKRVPAGNLS        60
     CVCGFSAAGW DRLFGQPRPA ELHPFREFSA GERRAPATPG DLLLHIRAEQ MDLCFELATH       120
     VMAQLGDAVT VVDEVHGFRY FDLRSMVGFV DGTENPTGRE ALDFTLVDDA DPDFAGGSYV       180
     LVQKYLHDMD GWNALSVETQ ERIIGRTKLS DIELDEAVKP SNSHSALTTL EENGQEIKIL       240
     RDNMPFGRPG SGEFGTYFIG YARSPAPIEQ MLENMVVGRP PGNYDRLLDF SRAVTGGLFF       300
     APSADLLEAL AERDPQDTDG SRLDPAPAAR APHDGSLNIG SLKGNPQQ                    348
//

If you have problems or comments...

PBIL Back to PBIL home page