(data stored in ACNUC1104 zone)

EMBL: BX640427.PE120

BX640427.PE120       Location/Qualifiers
FT   CDS             complement(115918..117216)
FT                   /transl_table=11
FT                   /locus_tag="BPP1411"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 6e-53, 40.67% id in 418 aa, and
FT                   to Rhizobium meliloti hypothetical protein Ra0081 or
FT                   Sma0151 SWALL:Q930W3 (EMBL:AE007202) (866 aa) fasta scores:
FT                   E(): 7.9e-52, 41.62% id in 382 aa"
FT                   /db_xref="GOA:Q7WAG6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG6"
FT                   /protein_id="CAE36713.1"
FT                   /translation="MDAVLILTVILGLFGLLLVLGIPIFAALGVPSILGIYLVGGASAL
FT                   NVVPSVLHRGIASYSLICIPLFILMGETLARTSIGARLYTLFYTWLSRVRCSLAIASVG
FT                   ASAIFGAMSGVSVAGAATIGRVAIPEMLKRRYDPGLAGGSVAAAGSLALLIPPSVGFVL
FT                   YGEIASQSIGKLFSAAIVPGLLLSVLMMLYLYGLSRIKPSVAPDEAQKVSWRERWQALR
FT                   DVWAAIVLIVAVLGTIYLGIATPTEASGLGAAGALLVALGYRELDRAKLREIVRSTIVT
FT                   SSMILLIVAAALLFGHVLMRLQAPQMLIAWVAALAQPDWVILLLILVFLLIVGMFLDIV
FT                   SIILITTPIVLPVITSLGLDPIWFGVVMIIMCEMAVITPPIGLNLYVIKGVAPEISLRD
FT                   ITMGALPFVLVEALAVLILVLFPQLALWLPSHM"
     MDAVLILTVI LGLFGLLLVL GIPIFAALGV PSILGIYLVG GASALNVVPS VLHRGIASYS        60
     LICIPLFILM GETLARTSIG ARLYTLFYTW LSRVRCSLAI ASVGASAIFG AMSGVSVAGA       120
     ATIGRVAIPE MLKRRYDPGL AGGSVAAAGS LALLIPPSVG FVLYGEIASQ SIGKLFSAAI       180
     VPGLLLSVLM MLYLYGLSRI KPSVAPDEAQ KVSWRERWQA LRDVWAAIVL IVAVLGTIYL       240
     GIATPTEASG LGAAGALLVA LGYRELDRAK LREIVRSTIV TSSMILLIVA AALLFGHVLM       300
     RLQAPQMLIA WVAALAQPDW VILLLILVFL LIVGMFLDIV SIILITTPIV LPVITSLGLD       360
     PIWFGVVMII MCEMAVITPP IGLNLYVIKG VAPEISLRDI TMGALPFVLV EALAVLILVL       420
     FPQLALWLPS HM                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page