(data stored in ACNUC1104 zone)

EMBL: BX640427.PE121

BX640427.PE121       Location/Qualifiers
FT   CDS             complement(117220..117741)
FT                   /transl_table=11
FT                   /locus_tag="BPP1412"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Klebsiella pneumoniae putative small
FT                   integral C4-dicarboxylate membrane transport protein DctQ
FT                   dctQ SWALL:Q9RN75 (EMBL:AF186091) (136 aa) fasta scores:
FT                   E(): 1.3e-05, 26.89% id in 119 aa"
FT                   /db_xref="GOA:Q7WAG5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG5"
FT                   /protein_id="CAE36714.1"
FT                   /translation="MKSLLDRLTRIGHGTNRAAVFIAQAALLLMMLLTVYSVIARYVLQ
FT                   QPSVHAVEISIYLLLLVTWLSVGWTHLLERHVSMEMLSIRVRGRGKRLLNVFRELVVLV
FT                   FCGFLLHAGVQIAATALARNYRSTSLLAFPMWIAYGLIAVGALLLAIAAACKLNHPDGN
FT                   AAIAPPSPEA"
     MKSLLDRLTR IGHGTNRAAV FIAQAALLLM MLLTVYSVIA RYVLQQPSVH AVEISIYLLL        60
     LVTWLSVGWT HLLERHVSME MLSIRVRGRG KRLLNVFREL VVLVFCGFLL HAGVQIAATA       120
     LARNYRSTSL LAFPMWIAYG LIAVGALLLA IAAACKLNHP DGNAAIAPPS PEA              173
//

If you have problems or comments...

PBIL Back to PBIL home page