(data stored in ACNUC1104 zone)

EMBL: BX640427.PE122

BX640427.PE122       Location/Qualifiers
FT   CDS             complement(117783..118790)
FT                   /transl_table=11
FT                   /locus_tag="BPP1413"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="Similar to Rhizobium meliloti putative periplasmic
FT                   binding protein R01699 or smc00271 SWALL:Q92PN7
FT                   (EMBL:AL591788) (325 aa) fasta scores: E(): 1.4e-16, 29.2%
FT                   id in 315 aa, and to Pasteurella multocida hypothetical
FT                   protein Pm1252 SWALL:Q9CLH9 (EMBL:AE006164) (328 aa) fasta
FT                   scores: E(): 4.7e-18, 28.66% id in 314 aa"
FT                   /db_xref="GOA:Q7WAG4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG4"
FT                   /protein_id="CAE36715.1"
FT                   /translation="MNKTWIAKLLPAVLLALSANAGAADKPIELTLSTYAPPSYEYMWK
FT                   PLETFIAYVEKESQGRVKIKAFHSAQLFDGYEELPALSRGDIDITTVVSTYASGAMPVL
FT                   NLFTMPFVFQDTAHLERAAKAGLLDVSIRGEMRDKYGIEVLGLAPIDPYQIYSRRAPVR
FT                   TAADFKGKVWATTGAADARAIQLLGGSPTSMPSSELYLALDRGVVDGTPRPLITGLGRS
FT                   LHEVVKHLSLATLAIDTSLLSMNKAKFDSLPPDIQDIIRRGAQVRDEEQFRQVYAYIEQ
FT                   GVAKFEKNGVSVYTIEPAALQDMRAATQPAVQEWVAQEPAASRHLELLEKTRAN"
     MNKTWIAKLL PAVLLALSAN AGAADKPIEL TLSTYAPPSY EYMWKPLETF IAYVEKESQG        60
     RVKIKAFHSA QLFDGYEELP ALSRGDIDIT TVVSTYASGA MPVLNLFTMP FVFQDTAHLE       120
     RAAKAGLLDV SIRGEMRDKY GIEVLGLAPI DPYQIYSRRA PVRTAADFKG KVWATTGAAD       180
     ARAIQLLGGS PTSMPSSELY LALDRGVVDG TPRPLITGLG RSLHEVVKHL SLATLAIDTS       240
     LLSMNKAKFD SLPPDIQDII RRGAQVRDEE QFRQVYAYIE QGVAKFEKNG VSVYTIEPAA       300
     LQDMRAATQP AVQEWVAQEP AASRHLELLE KTRAN                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page