(data stored in ACNUC1104 zone)

EMBL: BX640427.PE123

BX640427.PE123       Location/Qualifiers
FT   CDS             complement(118815..119441)
FT                   /transl_table=11
FT                   /locus_tag="BPP1414"
FT                   /product="putative isochorismatase"
FT                   /note="Similar to Escherichia coli isochorismatase EntB or
FT                   EntG or B0595 or Z0737 or Ecs0634 SWALL:ENTB_ECOLI
FT                   (SWALL:P15048) (285 aa) fasta scores: E(): 2.2e-06, 30.15%
FT                   id in 189 aa, and to Arthrobacter sp N-carbamoylsarcosine
FT                   amidase SWALL:CSH_ARTSP (SWALL:P32400) (264 aa) fasta
FT                   scores: E(): 1.8e-12, 31.86% id in 204 aa"
FT                   /db_xref="GOA:Q7WAG3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG3"
FT                   /protein_id="CAE36716.1"
FT                   /translation="MLDLDNARGGFIGSHPFGRRPALVVIDFQRAFTDPDVSPLASDCA
FT                   PAIAQANRLIQAMRGRGPVVFTVVGYDGNHGDGGCFHRKCPPLKDLVRGSAGCALDERL
FT                   DYDAATDVLLHKTQASAFFGTPLAAMLAHAGCDAVLIAGCTTSGCVRASAVDAMQHGFP
FT                   PFVAQDAVTDRSAAQHLSNLIDLKSKYAEVLPTDALLPLLLNPTA"
     MLDLDNARGG FIGSHPFGRR PALVVIDFQR AFTDPDVSPL ASDCAPAIAQ ANRLIQAMRG        60
     RGPVVFTVVG YDGNHGDGGC FHRKCPPLKD LVRGSAGCAL DERLDYDAAT DVLLHKTQAS       120
     AFFGTPLAAM LAHAGCDAVL IAGCTTSGCV RASAVDAMQH GFPPFVAQDA VTDRSAAQHL       180
     SNLIDLKSKY AEVLPTDALL PLLLNPTA                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page