(data stored in ACNUC1104 zone)

EMBL: BX640427.PE126

BX640427.PE126       Location/Qualifiers
FT   CDS             121851..122705
FT                   /transl_table=11
FT                   /locus_tag="BPP1417"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2115"
FT                   /db_xref="GOA:Q7WAG0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG0"
FT                   /protein_id="CAE36719.1"
FT                   /translation="MAAKQSLVCLTFDFDAISVWLARGMDSPTPVSRGEFCAVAADRVL
FT                   DLLERLGLPSTWFIPGHTLASYPEHCRRVHEAGHEIGHHGWTHVAPNLMTREEELDGLV
FT                   RANEAIRALTGRAARGYRSPSWDLSPHTLALLLEHGFDYDSSMMGHDYLPYPVRQGDSF
FT                   PLDEPAVFGAPTRLIEVPVSWSLDDYPHFEFVRAGQSVIPGLMNANSVMDNWIEDFLYL
FT                   KENFDWGVITYTFHPFVIGRGHRMRMLERLLRRLIDEGATFVRMEEAVDAYRQRQALAA
FT                   GAA"
     MAAKQSLVCL TFDFDAISVW LARGMDSPTP VSRGEFCAVA ADRVLDLLER LGLPSTWFIP        60
     GHTLASYPEH CRRVHEAGHE IGHHGWTHVA PNLMTREEEL DGLVRANEAI RALTGRAARG       120
     YRSPSWDLSP HTLALLLEHG FDYDSSMMGH DYLPYPVRQG DSFPLDEPAV FGAPTRLIEV       180
     PVSWSLDDYP HFEFVRAGQS VIPGLMNANS VMDNWIEDFL YLKENFDWGV ITYTFHPFVI       240
     GRGHRMRMLE RLLRRLIDEG ATFVRMEEAV DAYRQRQALA AGAA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page