(data stored in ACNUC1104 zone)

EMBL: BX640427.PE13

BX640427.PE13        Location/Qualifiers
FT   CDS             complement(11537..12691)
FT                   /transl_table=11
FT                   /locus_tag="BPP1304"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Thermoplasma volcanium L-carnitine
FT                   dehydratase Tv1186 or Tvg1215416 SWALL:Q979H5
FT                   (EMBL:AP000995) (399 aa) fasta scores: E(): 1.6e-53, 39.08%
FT                   id in 371 aa, and to Rhizobium meliloti putative conserved
FT                   membrane-anchored protein Rb0848 or Smb21182 SWALL:Q92V66
FT                   (EMBL:AL603645) (394 aa) fasta scores: E(): 3.5e-50, 37.83%
FT                   id in 378 aa"
FT                   /db_xref="GOA:Q7WAR5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR5"
FT                   /protein_id="CAE36606.1"
FT                   /translation="MTGALQGLRVLDMGQWIAAPYCTAMLADFGAEVIKIEKPGGGDDQ
FT                   RHSSPFVDGQSAFFNLFNRNKHSVTIDLSTPAGRAQCRDLIGSADVLVENYRPGVMARL
FT                   GLDYATLHAEFPRLVYCSISGFGQSGPMRGEGGFDLVIQAMSGLAAQCGPTDGPAHRLP
FT                   IPIVDVSTALFATIGVLTALAARQQTGTGQLVDVALLDSALAMAPLEVADYLATGHNPE
FT                   RMGQASRNAAPYQIFRTQDGAIALGAASQGLWEKTCDLLDRPALKNDPRFADNTARLAH
FT                   RAVLAELVEQALATQPSEHWLARLREAGIPAGPVLSYADILRHPQVAAREMVRRPETAG
FT                   AATAATLASPIRLSDTPARFVSGAPALGAHNGLLASGTRTGPPA"
     MTGALQGLRV LDMGQWIAAP YCTAMLADFG AEVIKIEKPG GGDDQRHSSP FVDGQSAFFN        60
     LFNRNKHSVT IDLSTPAGRA QCRDLIGSAD VLVENYRPGV MARLGLDYAT LHAEFPRLVY       120
     CSISGFGQSG PMRGEGGFDL VIQAMSGLAA QCGPTDGPAH RLPIPIVDVS TALFATIGVL       180
     TALAARQQTG TGQLVDVALL DSALAMAPLE VADYLATGHN PERMGQASRN AAPYQIFRTQ       240
     DGAIALGAAS QGLWEKTCDL LDRPALKNDP RFADNTARLA HRAVLAELVE QALATQPSEH       300
     WLARLREAGI PAGPVLSYAD ILRHPQVAAR EMVRRPETAG AATAATLASP IRLSDTPARF       360
     VSGAPALGAH NGLLASGTRT GPPA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page