(data stored in ACNUC1104 zone)

EMBL: BX640427.PE130

BX640427.PE130       Location/Qualifiers
FT   CDS             complement(126099..127604)
FT                   /transl_table=11
FT                   /locus_tag="BPP1421"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2111"
FT                   /db_xref="GOA:Q7WAF6"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF6"
FT                   /protein_id="CAE36723.1"
FT                   /translation="MHILVAGFQHETNTFAPSKAGYDNFLRGEGFPALVRGDDLLALRA
FT                   VNIPAGGFLNAALADGHSVHPVLWAGASPSAHVTRDAFERIAGEIEAAARAGRYDAVYL
FT                   DLHGAMVTEHHDDGEGELLRRLRDAVGPATPIVASLDLHANVTRAMLAHASALVAYHTY
FT                   PHVDMADTGARAAALLQARAQAGKHWHGAARRLPFLIPINGMCTQLEPARGVYALLAEL
FT                   ERSEPGIASLSCALGFPAADFPECGPVVWAHGPDRDAVERAVQTLADRIAGLEAQWAPD
FT                   FLAPDEAIRQARQLAQGARRPVVIADTQDNPGAGGDANTTGMLRALIDADADNAAIGLM
FT                   CDPQAVAQALAAGVGKCVRLRLGGQSGVAGDAPCEAEFIVEHQSDGKTRYDGPMMHGMA
FT                   ADLGPTVCLRHRGVRVIVSSNKSQTLDRNLIRLGGIDPEDLAILVVKSSVHFRADFEPI
FT                   AHAVLIAKAPGPMQADPADLPWTRLAPGMRTRPRGRPFVPARP"
     MHILVAGFQH ETNTFAPSKA GYDNFLRGEG FPALVRGDDL LALRAVNIPA GGFLNAALAD        60
     GHSVHPVLWA GASPSAHVTR DAFERIAGEI EAAARAGRYD AVYLDLHGAM VTEHHDDGEG       120
     ELLRRLRDAV GPATPIVASL DLHANVTRAM LAHASALVAY HTYPHVDMAD TGARAAALLQ       180
     ARAQAGKHWH GAARRLPFLI PINGMCTQLE PARGVYALLA ELERSEPGIA SLSCALGFPA       240
     ADFPECGPVV WAHGPDRDAV ERAVQTLADR IAGLEAQWAP DFLAPDEAIR QARQLAQGAR       300
     RPVVIADTQD NPGAGGDANT TGMLRALIDA DADNAAIGLM CDPQAVAQAL AAGVGKCVRL       360
     RLGGQSGVAG DAPCEAEFIV EHQSDGKTRY DGPMMHGMAA DLGPTVCLRH RGVRVIVSSN       420
     KSQTLDRNLI RLGGIDPEDL AILVVKSSVH FRADFEPIAH AVLIAKAPGP MQADPADLPW       480
     TRLAPGMRTR PRGRPFVPAR P                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page