(data stored in ACNUC1104 zone)

EMBL: BX640427.PE132

BX640427.PE132       Location/Qualifiers
FT   CDS             complement(128498..128944)
FT                   /transl_table=11
FT                   /locus_tag="BPP1423"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2109"
FT                   /db_xref="GOA:Q7WAF4"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF4"
FT                   /protein_id="CAE36725.1"
FT                   /translation="MTYPILLALHLLAAFVFIGTVFFEVLILESVRRQVPREAMNAVER
FT                   GIGNRARAIMPWVLLALFGAGIGMAWQHRGALEQPLASSFGLLLSLKIVLALSVLGHFA
FT                   AAMRWRRRGQLRGRRSRRLHLSVFCHLVAIVLLAKGMYYIDALR"
     MTYPILLALH LLAAFVFIGT VFFEVLILES VRRQVPREAM NAVERGIGNR ARAIMPWVLL        60
     ALFGAGIGMA WQHRGALEQP LASSFGLLLS LKIVLALSVL GHFAAAMRWR RRGQLRGRRS       120
     RRLHLSVFCH LVAIVLLAKG MYYIDALR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page