(data stored in ACNUC1104 zone)

EMBL: BX640427.PE133

BX640427.PE133       Location/Qualifiers
FT   CDS             complement(128941..130167)
FT                   /transl_table=11
FT                   /locus_tag="BPP1424"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2108"
FT                   /db_xref="GOA:Q7WAF3"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF3"
FT                   /protein_id="CAE36726.1"
FT                   /translation="MAELLQIDEPAAGRAAPQWRAFLELGFRPLYLVGAAWGALSVALW
FT                   IGAPQWLGGAMAGVIWHAHEMLWGFIGAIAVGFLLTAAATWTGVNPLRGAPLAALAALW
FT                   LAARAAFLLPGMAAFWTGVACELLFFAWAAAALGRAIYRRGASRRNDGVPLLVLGLGAA
FT                   DALYLLAARAGDYPLLLQRFNAGLLCMAVIALLIARRIIPFFAMRAIAGLQIPMHTRSG
FT                   QWQLAAGLVAVAATLAQAGALTAVALAAAGLIALAQWLSWRPWATRGVPLLWILYTGYL
FT                   GLAAGLLVAAASAAGGIARAAWPAHVIGMAGFGLLIIGMITRTALGHLGRPLRTDRLML
FT                   ACYLLVIGAAALRLAALWPGPHTLAALHGATAAWVLAFVLYLWRFAPLLVRPRLRAPTA
FT                   AAMPVRSRP"
     MAELLQIDEP AAGRAAPQWR AFLELGFRPL YLVGAAWGAL SVALWIGAPQ WLGGAMAGVI        60
     WHAHEMLWGF IGAIAVGFLL TAAATWTGVN PLRGAPLAAL AALWLAARAA FLLPGMAAFW       120
     TGVACELLFF AWAAAALGRA IYRRGASRRN DGVPLLVLGL GAADALYLLA ARAGDYPLLL       180
     QRFNAGLLCM AVIALLIARR IIPFFAMRAI AGLQIPMHTR SGQWQLAAGL VAVAATLAQA       240
     GALTAVALAA AGLIALAQWL SWRPWATRGV PLLWILYTGY LGLAAGLLVA AASAAGGIAR       300
     AAWPAHVIGM AGFGLLIIGM ITRTALGHLG RPLRTDRLML ACYLLVIGAA ALRLAALWPG       360
     PHTLAALHGA TAAWVLAFVL YLWRFAPLLV RPRLRAPTAA AMPVRSRP                    408
//

If you have problems or comments...

PBIL Back to PBIL home page