(data stored in ACNUC1104 zone)

EMBL: BX640427.PE135

BX640427.PE135       Location/Qualifiers
FT   CDS             130724..131026
FT                   /transl_table=11
FT                   /locus_tag="BPP1426"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2106"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2OJL"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF1"
FT                   /protein_id="CAE36728.1"
FT                   /translation="MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVAL
FT                   VPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHLDPGRPLGHIDGRPKP"
     MITPPDHPPR IAIQYCTQCQ WLLRAAWMAQ ELLSTFGADL GEVALVPGTG GVFRIHYNGA        60
     PLWDREVDGG FPEAKVLKQR VRDHLDPGRP LGHIDGRPKP                             100
//

If you have problems or comments...

PBIL Back to PBIL home page