(data stored in ACNUC1104 zone)

EMBL: BX640427.PE136

BX640427.PE136       Location/Qualifiers
FT   CDS             complement(131023..131793)
FT                   /transl_table=11
FT                   /locus_tag="BPP1427"
FT                   /product="putative amino-acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1362"
FT                   /db_xref="GOA:Q7WAF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF0"
FT                   /protein_id="CAE36729.1"
FT                   /translation="MIGLQGIDKSFGGNRVLHGVDVVIPEGSVTALIGPSGSGKSTLLR
FT                   CVNLLEIPEAGVLRLGPETLAFDGRRPARDAVQRIRRQTGMVFQNFQLFPHQSVIDNVM
FT                   EGLVTVQRWDKPRARARAMELLEKVGMTAKADAWPVTLSGGQQQRVAIARALASSPRVL
FT                   LCDEPTSALDPSLAIEVVDVLRRLAGEGMTMLMATHDLRLAASIAQQVVFLEGGAVVEA
FT                   GTPREVFAQSRDARTAAFVSTLTQGLPEEWSAPA"
     MIGLQGIDKS FGGNRVLHGV DVVIPEGSVT ALIGPSGSGK STLLRCVNLL EIPEAGVLRL        60
     GPETLAFDGR RPARDAVQRI RRQTGMVFQN FQLFPHQSVI DNVMEGLVTV QRWDKPRARA       120
     RAMELLEKVG MTAKADAWPV TLSGGQQQRV AIARALASSP RVLLCDEPTS ALDPSLAIEV       180
     VDVLRRLAGE GMTMLMATHD LRLAASIAQQ VVFLEGGAVV EAGTPREVFA QSRDARTAAF       240
     VSTLTQGLPE EWSAPA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page