(data stored in ACNUC1104 zone)

EMBL: BX640427.PE137

BX640427.PE137       Location/Qualifiers
FT   CDS             complement(131790..132470)
FT                   /transl_table=11
FT                   /locus_tag="BPP1428"
FT                   /product="putative amino-acid ABC transporter, permease
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1363"
FT                   /db_xref="GOA:Q7WAE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE9"
FT                   /protein_id="CAE36730.1"
FT                   /translation="MPAWLQLMLDSFWPLLHAGLMFTVPLTLLSFAAGLALAFVVALLR
FT                   LFGPWPIVALMRFYVWLIRGTPLLVQLFVIFYGLPSVGIVLDPLPAALIGFTLNVGAYN
FT                   SEVIRGAIESIPRGQWEAAYSLSMTRGQAMRRTVLPQAARVAVPPLANSFIALVKDTSL
FT                   AAVLTVPEIFQAAQRIAAVTYEPLILYTEAALIYLVFSSALSSLQVHLEKRFGQHAVFA
FT                   EQHR"
     MPAWLQLMLD SFWPLLHAGL MFTVPLTLLS FAAGLALAFV VALLRLFGPW PIVALMRFYV        60
     WLIRGTPLLV QLFVIFYGLP SVGIVLDPLP AALIGFTLNV GAYNSEVIRG AIESIPRGQW       120
     EAAYSLSMTR GQAMRRTVLP QAARVAVPPL ANSFIALVKD TSLAAVLTVP EIFQAAQRIA       180
     AVTYEPLILY TEAALIYLVF SSALSSLQVH LEKRFGQHAV FAEQHR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page