(data stored in ACNUC1104 zone)

EMBL: BX640427.PE14

BX640427.PE14        Location/Qualifiers
FT   CDS             complement(12688..13554)
FT                   /transl_table=11
FT                   /locus_tag="BPP1305"
FT                   /product="putative (R)-specific enoyl-CoA hydratase"
FT                   /note="Similar to Pseudomonas aeruginosa (R)-specific
FT                   enoyl-CoA hydratase Phaj2 or Pa1018 SWALL:Q9LBK1
FT                   (EMBL:AB040026) (288 aa) fasta scores: E(): 2.7e-41, 43.55%
FT                   id in 287 aa, and to Mycobacterium tuberculosis
FT                   hypothetical 30.2 kDa protein Ufaa2 or Rv3538 or Mt3642 or
FT                   Mtcy03c7.18C SWALL:P71863 (EMBL:Z82098) (286 aa) fasta
FT                   scores: E(): 8.9e-30, 38.94% id in 285 aa"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR4"
FT                   /protein_id="CAE36607.1"
FT                   /translation="MNVQALLAHEFPVETQSYGARDCSLYALSAGYGQDPMDERQLQYV
FT                   YGDAPKTAGGMALVLANPGFWQRQPWTGIDWARCVLGEQRIATHRPLPAAGRIASQLRV
FT                   TRITDKGRQFGAMLHAERTLHDADNGTHYATLSMVTICRGDGGFGGPPDDSTRLPAVPA
FT                   RAPDIQTEQPTLPQQALLFDLHGIVNPVHSWPAAARQAGYPRPFLHGVCLMGLVQHAIA
FT                   RELAAYDTDGIATLSARFRGVFYPGETLLLSLWRDGDQVRYEAHAKERSTLAVEGSARL
FT                   QPAGAVQ"
     MNVQALLAHE FPVETQSYGA RDCSLYALSA GYGQDPMDER QLQYVYGDAP KTAGGMALVL        60
     ANPGFWQRQP WTGIDWARCV LGEQRIATHR PLPAAGRIAS QLRVTRITDK GRQFGAMLHA       120
     ERTLHDADNG THYATLSMVT ICRGDGGFGG PPDDSTRLPA VPARAPDIQT EQPTLPQQAL       180
     LFDLHGIVNP VHSWPAAARQ AGYPRPFLHG VCLMGLVQHA IARELAAYDT DGIATLSARF       240
     RGVFYPGETL LLSLWRDGDQ VRYEAHAKER STLAVEGSAR LQPAGAVQ                    288
//

If you have problems or comments...

PBIL Back to PBIL home page