(data stored in ACNUC1104 zone)

EMBL: BX640427.PE141

BX640427.PE141       Location/Qualifiers
FT   CDS             136512..137096
FT                   /transl_table=11
FT                   /locus_tag="BPP1432"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2703"
FT                   /db_xref="GOA:Q7WAE5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE5"
FT                   /protein_id="CAE36734.1"
FT                   /translation="MTVSPLHALTSRRSMKFLRAPAPKQDELEQILQAAMSAPDHGALR
FT                   PWRFVLIRGEAIGRLADLAIEAVKRSGDKRMTPEKEKSVREWAAGVPLFIAVAQKISHD
FT                   NTRIPEQEQLLATGAAVMNILNAAHMLGYGAFWSTGLGTYVEDVQDALGLDAMDYRFLG
FT                   FVALGTPGCAVPPAQRPDFREFVSEWQGVTV"
     MTVSPLHALT SRRSMKFLRA PAPKQDELEQ ILQAAMSAPD HGALRPWRFV LIRGEAIGRL        60
     ADLAIEAVKR SGDKRMTPEK EKSVREWAAG VPLFIAVAQK ISHDNTRIPE QEQLLATGAA       120
     VMNILNAAHM LGYGAFWSTG LGTYVEDVQD ALGLDAMDYR FLGFVALGTP GCAVPPAQRP       180
     DFREFVSEWQ GVTV                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page