(data stored in ACNUC1104 zone)

EMBL: BX640427.PE149

BX640427.PE149       Location/Qualifiers
FT   CDS             complement(145110..145655)
FT                   /transl_table=11
FT                   /locus_tag="BPP1440"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD7"
FT                   /protein_id="CAE36742.1"
FT                   /translation="MLPIVIVSGPPGSGKTTACGLLAQADPQGLHLPSDLFYGFPAHPI
FT                   PPYRPQADAQNAAVIRAVCRSAASFAADGYRVYLDGIFGPWFLPLIAAQLQAARCPAAY
FT                   ALLDIGLDEALARVEQRSGPGQASMVRTMHDAFRAAGSLAGHRVVTAGRPAAEIADEIA
FT                   GRLQAGALALDLARWAPG"
     MLPIVIVSGP PGSGKTTACG LLAQADPQGL HLPSDLFYGF PAHPIPPYRP QADAQNAAVI        60
     RAVCRSAASF AADGYRVYLD GIFGPWFLPL IAAQLQAARC PAAYALLDIG LDEALARVEQ       120
     RSGPGQASMV RTMHDAFRAA GSLAGHRVVT AGRPAAEIAD EIAGRLQAGA LALDLARWAP       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page