(data stored in ACNUC1104 zone)

EMBL: BX640427.PE15

BX640427.PE15        Location/Qualifiers
FT   CDS             complement(13568..14536)
FT                   /transl_table=11
FT                   /locus_tag="BPP1306"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 2.4e-48, 44.89% id in 323 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 9.3e-39, 38.31%
FT                   id in 321 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR3"
FT                   /protein_id="CAE36608.1"
FT                   /translation="MFCRKLALALGMAVSALSAGAAAAPYPAEPVRLVVPYAPGGTTDL
FT                   LARLIASKLSAKYERQVVVENKTGAGGNIAAGFLARSRPDGYTLMMASIGQFAINPLIF
FT                   SAPGYDAAKDFQPVIQVTRVPNVLVVNAASKLDSLQDLIKLAQAQPSVTYASSGNGSSN
FT                   HLAGALLAHMANIDMLHIPYKGSAPGLQALYGGDVQVMFDNLSSALPHVQGGKLRALGV
FT                   SSETRFSKLPDVPTIAESGLPGYEASAWFGLVAPAGTPAAIVEQLNRDVAAVLADNDVR
FT                   SKLLEMGMTPQGGSVAQFQAVIDADIQKWKPIVQSLNLAVN"
     MFCRKLALAL GMAVSALSAG AAAAPYPAEP VRLVVPYAPG GTTDLLARLI ASKLSAKYER        60
     QVVVENKTGA GGNIAAGFLA RSRPDGYTLM MASIGQFAIN PLIFSAPGYD AAKDFQPVIQ       120
     VTRVPNVLVV NAASKLDSLQ DLIKLAQAQP SVTYASSGNG SSNHLAGALL AHMANIDMLH       180
     IPYKGSAPGL QALYGGDVQV MFDNLSSALP HVQGGKLRAL GVSSETRFSK LPDVPTIAES       240
     GLPGYEASAW FGLVAPAGTP AAIVEQLNRD VAAVLADNDV RSKLLEMGMT PQGGSVAQFQ       300
     AVIDADIQKW KPIVQSLNLA VN                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page