(data stored in ACNUC1104 zone)

EMBL: BX640427.PE152

BX640427.PE152       Location/Qualifiers
FT   CDS             148389..149906
FT                   /transl_table=11
FT                   /locus_tag="BPP1443"
FT                   /product="ABC-transport protein, solute-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2692"
FT                   /db_xref="GOA:Q7WAD4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD4"
FT                   /protein_id="CAE36745.1"
FT                   /translation="MTKTKSLSMMMGAAVLAGAGGAALAQDLRIGLQEDPDVLDPHRAR
FT                   TYVGRSLNVSVLLSSLKLHDCASCGTNCSFSSMSTSLSHNEVKTMRTDVQFHDGSKFDA
FT                   AAARANLERAMTLQDSMRKGELASVEKIEAPDPATLVLTLKRPDATLLAQLSDRAGMML
FT                   SPKAFEGDAAAVGRKPVCSGPYKFVERVQNDRIVLQKFDQYYGAKDYHFDKLVFLPIPD
FT                   TTVRLSNLRAGGLDILERMNPSDAPQVKNDASVQFMPVSGLGYQEVFFNTGNGKRAETN
FT                   PFKDKRVRQALALSIDRAIINEVVGGGIFDPASQPFPPASPYHSDKFPVPKRDVERARA
FT                   LLKQAGLQKVKAEFAFGNNTTTSAIAEMIQAMAAEAGFELSLRPTEYAAMLNEAQAGNF
FT                   EMIMRGWSGRVDPDGNIYQFVTCKGALNDGRYCNAEVDKLLAEARTVPDQAKRKAIYDQ
FT                   AQALLQADTHDIYLYYQPWPFVLGKNVRGFKPYPDGMVRLKGVTLAK"
     MTKTKSLSMM MGAAVLAGAG GAALAQDLRI GLQEDPDVLD PHRARTYVGR SLNVSVLLSS        60
     LKLHDCASCG TNCSFSSMST SLSHNEVKTM RTDVQFHDGS KFDAAAARAN LERAMTLQDS       120
     MRKGELASVE KIEAPDPATL VLTLKRPDAT LLAQLSDRAG MMLSPKAFEG DAAAVGRKPV       180
     CSGPYKFVER VQNDRIVLQK FDQYYGAKDY HFDKLVFLPI PDTTVRLSNL RAGGLDILER       240
     MNPSDAPQVK NDASVQFMPV SGLGYQEVFF NTGNGKRAET NPFKDKRVRQ ALALSIDRAI       300
     INEVVGGGIF DPASQPFPPA SPYHSDKFPV PKRDVERARA LLKQAGLQKV KAEFAFGNNT       360
     TTSAIAEMIQ AMAAEAGFEL SLRPTEYAAM LNEAQAGNFE MIMRGWSGRV DPDGNIYQFV       420
     TCKGALNDGR YCNAEVDKLL AEARTVPDQA KRKAIYDQAQ ALLQADTHDI YLYYQPWPFV       480
     LGKNVRGFKP YPDGMVRLKG VTLAK                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page