(data stored in ACNUC1104 zone)

EMBL: BX640427.PE154

BX640427.PE154       Location/Qualifiers
FT   CDS             150923..151798
FT                   /transl_table=11
FT                   /locus_tag="BPP1445"
FT                   /product="probable ABC-transport protein, inner membrane
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2690"
FT                   /db_xref="GOA:Q7WAD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD2"
FT                   /protein_id="CAE36747.1"
FT                   /translation="MSAPIASAGMAAPRRANRSWGKFRRNRIAMLGALIVLAFVVLALL
FT                   APWVASHDPFQTSFMTIRKAPSAAFWMGTDELGRDIFSRMVYGARASLMAGMVSVLIAL
FT                   AVGVPFGLAAGYFGGWTDSVISRATEALLAIPFLILAIALAAFLGPSLTNAMIAIGVSA
FT                   APKFIRLTRGQVLAVKNEDYVQSARALGASDLRIIGRHVFPNVMPPLIVQATITIATAI
FT                   IAEASLSFLGLGLQPPNPSWGSMLNTAKNFMTQAPWMSIFPGSAIFLVVLGFNLLGDGL
FT                   RDALDPRQEK"
     MSAPIASAGM AAPRRANRSW GKFRRNRIAM LGALIVLAFV VLALLAPWVA SHDPFQTSFM        60
     TIRKAPSAAF WMGTDELGRD IFSRMVYGAR ASLMAGMVSV LIALAVGVPF GLAAGYFGGW       120
     TDSVISRATE ALLAIPFLIL AIALAAFLGP SLTNAMIAIG VSAAPKFIRL TRGQVLAVKN       180
     EDYVQSARAL GASDLRIIGR HVFPNVMPPL IVQATITIAT AIIAEASLSF LGLGLQPPNP       240
     SWGSMLNTAK NFMTQAPWMS IFPGSAIFLV VLGFNLLGDG LRDALDPRQE K                291
//

If you have problems or comments...

PBIL Back to PBIL home page