(data stored in ACNUC1104 zone)

EMBL: BX640427.PE156

BX640427.PE156       Location/Qualifiers
FT   CDS             complement(153661..154305)
FT                   /transl_table=11
FT                   /locus_tag="BPP1447"
FT                   /product="LysE-family efflux protein"
FT                   /note="Similar to Caulobacter crescentus efflux protein,
FT                   LysE family Cc0456 SWALL:Q9AAY6 (EMBL:AE005719) (208 aa)
FT                   fasta scores: E(): 6.7e-38, 56.54% id in 214 aa, and to
FT                   Zymomonas mobilis hypothetical 17.5 kDa protein Zm10orf7
FT                   SWALL:Q9XBR8 (EMBL:AF157493) (158 aa) fasta scores: E():
FT                   1.1e-22, 49.06% id in 161 aa"
FT                   /db_xref="GOA:Q7WAD1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD1"
FT                   /protein_id="CAE36749.1"
FT                   /translation="MTPLAALLAFTVAATLLTITPGLDTALVLRTAAIDGPRRALLAGL
FT                   GVCAGCLAWGVAAALGLGALLAASSLAYDALRIAGAIYLCWLGARLLARSLRRRAGDAA
FT                   PGMLPAAPAGGGALQWFWRGCLTNMLNPKVGVFYVTFLPQFIPAGVDVLAFSLLLAALH
FT                   AALGLLWFAALVAATRPLSRWLARPSVARGLDRLSAGVFIAFGLKLALERR"
     MTPLAALLAF TVAATLLTIT PGLDTALVLR TAAIDGPRRA LLAGLGVCAG CLAWGVAAAL        60
     GLGALLAASS LAYDALRIAG AIYLCWLGAR LLARSLRRRA GDAAPGMLPA APAGGGALQW       120
     FWRGCLTNML NPKVGVFYVT FLPQFIPAGV DVLAFSLLLA ALHAALGLLW FAALVAATRP       180
     LSRWLARPSV ARGLDRLSAG VFIAFGLKLA LERR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page