(data stored in ACNUC1104 zone)

EMBL: BX640427.PE157

BX640427.PE157       Location/Qualifiers
FT   CDS             154397..154933
FT                   /transl_table=11
FT                   /locus_tag="BPP1448"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc0785 or Rs05053 SWALL:Q8Y1A5 (EMBL:AL646061)
FT                   (182 aa) fasta scores: E(): 1.5e-37, 55.23% id in 172 aa,
FT                   and to Yersinia pestis hypothetical protein Ypo1065
FT                   SWALL:Q8ZH46 (EMBL:AJ414146) (182 aa) fasta scores: E():
FT                   1.1e-30, 46.06% id in 178 aa"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD0"
FT                   /protein_id="CAE36750.1"
FT                   /translation="MALRATIYKADLHVADTDRHYYASHGLTIARHPSETDERMMVRVL
FT                   AYALHADEQLAFTKGLSDTDEPDLWRKDLTGDIELWVEVGQPDERRILKACGRAAEVVV
FT                   YCYGGHASQVWWDGVRGKLERARNLRVVCLPAAQTEALAQLARRTMQVHVNISDGAAFV
FT                   STDEGQVQVEPQSWR"
     MALRATIYKA DLHVADTDRH YYASHGLTIA RHPSETDERM MVRVLAYALH ADEQLAFTKG        60
     LSDTDEPDLW RKDLTGDIEL WVEVGQPDER RILKACGRAA EVVVYCYGGH ASQVWWDGVR       120
     GKLERARNLR VVCLPAAQTE ALAQLARRTM QVHVNISDGA AFVSTDEGQV QVEPQSWR         178
//

If you have problems or comments...

PBIL Back to PBIL home page