(data stored in ACNUC1104 zone)

EMBL: BX640427.PE159

BX640427.PE159       Location/Qualifiers
FT   CDS             complement(156325..156897)
FT                   /transl_table=11
FT                   /locus_tag="BPP1450"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0981"
FT                   /db_xref="GOA:Q7WAC9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAC9"
FT                   /protein_id="CAE36752.1"
FT                   /translation="MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRL
FT                   RVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGM
FT                   RRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFW
FT                   RAGQPLLVAECFLPAFWSLARAPVAPR"
     MTTPIPLARG WLPAAPSTLD PLRKYWLFRP GALTAGLRQL GHVRLRVLAE YPTGAPRDEA        60
     DGMRIAAQSP VWVREVLMSI DGVDSVVARS LTPLRASHGV WQGMRRLLTR PLADMLYHDP       120
     GIHRSVFVCR RLAAGVPFHA TAIARAPAGG PEPALWARRS AFWRAGQPLL VAECFLPAFW       180
     SLARAPVAPR                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page