(data stored in ACNUC1104 zone)

EMBL: BX640427.PE17

BX640427.PE17        Location/Qualifiers
FT   CDS             complement(15487..16476)
FT                   /transl_table=11
FT                   /locus_tag="BPP1308"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 1.5e-43, 42.03% id in 314 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 9.3e-40, 39.51%
FT                   id in 329 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR1"
FT                   /protein_id="CAE36610.1"
FT                   /translation="MQPRLTALHSALAALALCLPAGQAHAQADAAYPARPITLIVPFSA
FT                   GGGSDVVARILATGLGSQLKQTVIVENRTGAAGNIGAEAVARARPDGYTLLFGSMGVMS
FT                   VNSHLYRNMPLQPERDLAPVGRIYDTPHVIVVGQQSTLKSLPQLIEQAKARPDALTYAS
FT                   AGNGTSTHLVGALFMHETGTRLMHVPYKGNAPALNDTMAGHVDMMFDQATNSTGQIQAA
FT                   RLRALAATSHARIPDLPDVPTVAELGYPELEVTSWTVLAAPKATPAAAMATLSTALKKT
FT                   LADPAIKEKIRQTGGVINYQDLPSTTEFVNRETARWGALIQSAGITAN"
     MQPRLTALHS ALAALALCLP AGQAHAQADA AYPARPITLI VPFSAGGGSD VVARILATGL        60
     GSQLKQTVIV ENRTGAAGNI GAEAVARARP DGYTLLFGSM GVMSVNSHLY RNMPLQPERD       120
     LAPVGRIYDT PHVIVVGQQS TLKSLPQLIE QAKARPDALT YASAGNGTST HLVGALFMHE       180
     TGTRLMHVPY KGNAPALNDT MAGHVDMMFD QATNSTGQIQ AARLRALAAT SHARIPDLPD       240
     VPTVAELGYP ELEVTSWTVL AAPKATPAAA MATLSTALKK TLADPAIKEK IRQTGGVINY       300
     QDLPSTTEFV NRETARWGAL IQSAGITAN                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page