(data stored in ACNUC1104 zone)

EMBL: BX640427.PE186

BX640427.PE186       Location/Qualifiers
FT   CDS             190423..190812
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BPP1477"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1033"
FT                   /db_xref="GOA:Q7WAA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA3"
FT                   /protein_id="CAE36779.1"
FT                   /translation="MVDKGMKILVVDDFPTMRRIIRNLLKELGFENVDEAEDGAIGLEK
FT                   LRNGAFQFVVSDWNMPNLDGLEMLKQIRADAALKSLPVLMVTAEAKKENIVAAAQAGAN
FT                   GYVVKAFTAATLEEKLNKIFEKLAG"
     MVDKGMKILV VDDFPTMRRI IRNLLKELGF ENVDEAEDGA IGLEKLRNGA FQFVVSDWNM        60
     PNLDGLEMLK QIRADAALKS LPVLMVTAEA KKENIVAAAQ AGANGYVVKA FTAATLEEKL       120
     NKIFEKLAG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page